�ɲɾ�����ӯ�����һ��ˣ��������С���˴��ͣ�������P���ҹ��ñ˽��ά�Բ��������˸߸ԣ�������ơ��ҹ��ñ�����ά�Բ���ˡ���˳^�ӣ������ӡ� ���ͯj�ӣ��ƺ���ӣ� ? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!ELF>Â@È6@8 @@@@ØØèœèœ   �e�eдд°Ë°Û°Û`d0h¨*¨:¨:0088800hhhDDSåtd88800Påtdккк,,QåtdRåtd°Ë°Û°ÛPdPd/lib64/ld-linux-x86-64.so.2 GNUÀ€ÀGNU êfðÙòê?'ä ^0eGNU`�!€�#`cg(Œ Þ÷YOÖÀ³÷fUa8ò‹Ù+Œ2Ä÷³¢÷ì{ÛDWŒ¹oÍ}9¦éψ`zcF"Í4Ø*ÅWÔ�n=°(gÔUt²„Ä.{gk{3P„› «Hð<vo ü¸'¤÷¾Ëù”Ýt£BäŒ,äî±’ H™YM� —, ™âQ2 @ B€@@%@ @BÛ`B©€B@¨B_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__cxa_finalize__libc_start_main__cxa_atexitdelwinwattr_on__ctype_b_locwaddchwattr_offwmovestdscr__assert_failmallocstrncpystrlenmemsetstderrfwritesubwinderwinwtouchlnwerasewrefresh__vsnprintf_chkstrrchrmvwprintwstdout__vfprintf_chk__stack_chk_failstrdupstrchrcalloc__snprintf_chksocketconnectgettimeofdaysetsockoptfreeaddrinfoaccessgetaddrinfoperrorgai_strerrorsendendwindelscreen__fprintf_chkfputcstrcmpgetenvoptindoptargoptoptopterrmemmovestrncmpfopenfgetsstrpbrkfclosecli_regcompcli_regexeccli_regfree__errno_locationstrtollstrtolstrcasecmprecvmemchrmemcpy__ctype_tolower_locstrstrsscanfstrptimerealloc__printf_chkputcharputssignalstdinnewtermstart_colorkeypadnonlhalfdelaynoechocurs_setinit_pair__ctype_toupper_locwattrsetwbkgdctimeacs_mapwborderwgetchqsortuse_default_colorslibclamav.so.12libc.so.6libncurses.so.6libtinfo.so.6CLAMAV_PRIVATEGLIBC_2.4GLIBC_2.14GLIBC_2.34GLIBC_2.3GLIBC_2.2.5GLIBC_2.3.4° EÖèÀii ÷”‘–´‘– ii ui !ti -°Ûð¸Û°ÂÀÛÀÛèÛœøÛ ¡Ü`� Ü`�0܃žPÜ&¡`Ü`�hÜ`�x܃ž˜Ü=¡¨Ü`�°Ü`�À܃žàÜQ¡ðÜ`�øÜ`�ÝŽŸÝ ¡8Ý`�@Ý`�PÝn¡`Ý ¡€Ý`�ˆÝ`�˜Ýt¡¨Ý ¡ÈÝ`�ÐÝ`�àÝ»¤ðÝ ¡Þ`�Þ`�(Þ}¡8Þ ¡XÞP"`Þ`�pÞ‡¡€Þ ¡ Þ`�¨Þ`�¸Þ�¡ÈÞ ¡èÞ`�ðÞ`�ß™¡ß ¡0ß`�8ß`�Hߥ¡Xß ¡xß`�€ß`��ß³¡ ß ¡Àß`�Èß`�Øßº¡èß ¡à`�à`� àÁ¡0à ¡Pà`�Xà`�hàÈ¡xà ¡˜à`� à`�°àÕ¡àà`�èà`�øàß¡á ¡(á`�0á`�@áæ¡Pá ¡pá`�xá`�ˆáð¡˜á ¡¸á`�Àá`�Ðá÷¡àá ¡â`�â`�âþ¡(â ¡Hâ`�Pâ`�`âD°pâ ¡�âx"˜â`�¨â¢Èâ¢Øâ`�àâ`�ð⠢㠡 ã`�(ã`�8ã*¢Hã ¡hã¨"pã`�€ã2¢�ãF¢°ã`�¸ã`�ÈãO¢ØãF¢øã`�ä`�äd¢ ä ¡@ä`�Hä`�Xäi¢hä ¡ˆä`��ä`� ät¢Ðä`�Øä`�èä~¢øä ¡å`� å`�0凢`å`�hå`�x匢ˆå ¡¨å`�°å`�Àå‘¢Ðå ¡ðå`�øå`�欢8æ`�@æ`�P楢€æ`�ˆæ`�˜æª¢¨æ ¡Èæ`�Ðæ`�àæ±¢ç`�ç`�(ç¹¢Xç`�`ç`�pçÅ¢ ç`�¨ç`�¸çÍ¢èç`�ðç`�èÙ¢èF¢0è`�8è`�Hèï¢Xè ¡xè`�€è`��èø¢ è ¡Àè`�Èè`�Øèü¢èè ¡é`�é`� é£0é ¡Pé`�Xé`�hé.¢xé ¡˜é`� é`�°é£Àé ¡àé`�èé`�øé £ê ¡(ê`�0ê`�@ê£pê`�xê`�ˆê"£¸ê`�Àê`�Ðê1£ë`�ë`�ëA£Hë`�Pë`�`ëN£�ë`�˜ë`�¨ëT£¸ëF¢ØëØ"àëa£ðëf£ìF¢ ì0#(ì`�8ìm£HìF¢hìP#pì`�€ì«�ì ¡°ì`�¸ì`�Èìy£Øì ¡øì`�í`�í‚£@í`�Hí`�X퉣ˆí`��í`� í�£Ðí`�Øí`�èퟣî`� î`�0Pî¢`î`�hî`�x˜î¢¨î`�°î`�ÀÐî ¡ðî`�øî`�ïÄ£8ï`�@ï`�PïΣ€ï`�ˆï`�˜ïÒ£Èï`�Ðï`�àïç£ð`�ð`�(ðÚ£Xð`�`ð`�pð⣠ð`�¨ð`�¸ðì£èð`�ðð`�ñù£ñ ¡0ñx#8ñ`�HñužXñ ¡xñ`�€ñ`��ñ¤°ñ ¤Àñ`�Èñ`�Øñ¤èñ ¡ò`�ò`� ò¤Pò`�Xò`�hò,¤xò ¡˜ò°# ò`�°ò>¤Àò ¡àòà#èò`�øòŸ£ó ¡(ó$0ó`�@óM¤Pó ¡póV¤xó`�ˆót¤˜ó ¡¸ó@$Àó`�Ðó~¤ô`$ô`�ô„¤(ôF¢HôФPô`�`ôŸ¤pô ¡�ôˆ$˜ô`�¨ô³¤¸ô ¡Øô`�àô`�ðôäõ ¡ õ`�(õ`�8õÖ¤hõ`�põ`�€õᤰõ`�¸õ`�Èõì¤øõ`�ö`�öø¤ ö ¡@ö`�Hö`�Xöþ¤hö ¡ˆö`��ö`� ö¥°ö ¡Ðö`�Øö`�èö¥øö ¡÷`� ÷`�0÷)¥@÷ ¡`÷`�h÷`�x÷/¥ˆ÷ ¡¨÷`�°÷`�À÷6¥Ð÷ ¡ð÷`�ø÷`�ø>¥ø ¡8ø`�@ø`�PøE¥`ø ¡€ø`�ˆø`�˜øM¥¨ø ¡Èø`�Ðø`�àøU¥ðø ¡ù`�ù`�(ùf¥8ù ¡Xù`�`ù`�pù|¥€ù ¡ ù`�¨ù`�¸ù‹¥Èù ¡èù`�ðù`�ú¦¥úF¢0ú`�8ú`�Hú°¥Xúº¥xú`�€ú`��úÉ¥°úÏ¥Àú`�Èú`�ØúÓ¥øúÏ¥û`�û`� ûÙ¥@ûÏ¥Pû`�Xû`�hûÝ¥ˆûÏ¥˜û`� û`�°ûã¥ÐûÏ¥àû`�èû`�øûç¥üÏ¥(ü`�0ü`�@üë¥`üÏ¥pü`�xü`�ˆü泌üÏ¥¸ü`�Àü`�Ðüó¥ðüÏ¥ý`�ý`�ý÷¥ý¦(ý ¡Hý`�Pý`�Xý¦`ý#¦pýF¢�ý°$˜ý.¦ ý4¦¨ýB¦¸ý ¡ØýQ¦àý`�èý`¦ðýt¦ þØ$(þ`�0þ[³8þv³hþ%pþЦxþš¦�þ ¡°þ(%¸þ�Àþ¨¦Øþº¥øþ¨%ÿ·¦ÿº¦ ÿ ¡@ÿ¦Hÿ�PÿÞ¦hÿ ¡ˆÿè%�ÿ�˜ÿ禰ÿ ¡Ðÿ@&Øÿ�àÿñ¦ý¦x& §(§@ ¡`§h�p4§x>§ˆ ¡¨È&°�¸I§Ð ¡ð'ø�_§x§8ˆ'@g§H|§P�§€¨'ˆ—§�œ§˜®§¸¢Èð'Тض§à˧𠡘(ܧ ß§(ò§8F¢Xà(` ¨h ¨p¨ H)¨�°�žèð)ð!¨ø8¨0(*8I¨@T¨xX*€d¨ˆh¨  ¡À˜*È�ЛžèF¢È*`œ¥žPø*Xež`w¨xF¢˜�+ �¨¨“¨Àº¥àÐ+裨ð¨¨F¢(X,0¶¨8»¨PF¢pÀ,xɨ€¦²˜F¢¸ø,ÀϨÈÙ¨àF¢0-ΨÒ¨(F¢H¨-P�¨Xå¨pF¢�8.˜ô¨ Ù¨¸F¢ØÀ.àø¨èü¨F¢ /(ô¨0©HF¢h˜0pe¨xα°ð0¸©À ©È6©ØF¢øp1H©K©  ¡@c©HܧP~©h ¡ˆ 1�ܧ˜‘© ¢©° ¡ÐÈ1Ø�à«©øF¢ 2 µ©( ¹©@  ¡` h2h �p Ò©x ß©ˆ  ¡¨ 84° ܧ¸ í©ð x4ø ø© ª  ¡8 à6@ �H ª`  ¡€ (7ˆ �� 1ª˜ <ª¨  ¡È GªÐ ܧØ cªð  ¡ P7 ܧ iª8  ¡X x7` ܧh }ª€  ¡  °7¨ ܧ° ’ªè è8ð ¢ø —ª k¤  ¡0 898 �@  ªX ±ªh ʪx è9€ ʪˆ Öª� 檠 F¢À 8;È ÷ªÐ ýªØ «è  ¡ `; ܧ  « -«0 ¨;@ ;«P Ð;X ;«` @«h K«x =˜ 0=  V«¨ [«° e«À  ¡à Ø=è �ð p«ø {«(>0‡«8–«@¡«p°>x­«€½«ˆÄ«˜ ¡¸?À�ÈÌ«ÐÔ«à ¡ @�Ý«æ«( ¡H�AP�Xð«p ¡�0B˜ܧ ¬¨X¥¸ ¡Ø(Cà�è¬ði¥ ¡ ˆC(�0(¬88¬H ¡hÐCp�xI¬€a¬� ¡°�D¸�À{¬È“¬Ø ¡ø(Gܧ¥¬¬ F¢@PGHI©PÖ¬Xì¬hF¢ˆ°G�I©˜­° ¡ÐHØ�à­ø ¡xH ܧ(7­0@­@ ¡`ØHh�pJ­xS­ˆ ¡¨ˆI°�¸]­Àt­Ð ¡ðXJø��­’­ ¡8øJ@�H¥­P´­` ¡€�Kˆܧ�Ä­˜Õ­¨ ¡ÈàKÐܧØè­àþ­ð ¡pLܧ ®((®8 ¡X°L`ܧh<®pL®€ ¡ àL¨ܧ°Y®¸r®È ¡èpMð`�ø…®˜® ¡0àM8ܧ@­®HÈ®X ¡xHN€�ˆå®�í®  ¡À�NÈ�Ðö®Øþ®è ¡8O�¯ ¯0 ¡PàOX�` ¯h)¯x ¡˜˜P �¨3¯°?¯À ¡à0Qè�ðL¯øX¯ ¡(ÈQ0�8e¯@o¯P ¡ppRx�€z¯ˆ�¯˜ ¡¸SÀ�È£¯Ð¯¯à ¡0Tܧ½¯ɯ(F¢HUPÖ¯XÒ¶`ݯpº¥�HV˜ê¯ e±¨v±¸º¥ØhWࣨèå¶ðï¯F¢ ¸X(ý¯0ù¶8°HF¢hZp÷ªx °€°�º¥°àZ¸'°À+°È<°Øº¥øè['°N°\° º¥@è\Hk°Pn°X�°hº¥ˆø]�•°˜™° §°°º¥Ð_ض°à¹°èǰøF¢ ` Ö°(Ú°0å°@F¢`Xahñ°põ°x±ˆF¢¨xb° ±¸±À±ÐF¢ðàcø/±6±H±F¢8Xe@\±Ha±Pq±`º¥€gˆ£¨�ƒ±ÈxhЕ±Ø¢±Ài¶± ƱX`j`Ú±hë±€ ¡ àj¨ܧ°²ÈF¢èpkðÏ›ø²0 l8*²@3²Xº¥xm€·¦ˆG²  ¡ÀXmÈܧÐZ²è ¡Àm�m²0 ¡PPnX�`ƒ²xF¢˜Èn —²¨ž²ÀF¢àxoèbœð±² F¢( Ðp0 þ°8 DzP  ¡p Xqx �ˆ Û²¸ `�À `�Ð æ²!`�!`�!ó²!ý²(! ¡H!`�P!`�X! ³`!³p!F¢�!`�˜!`� !!³¨!0³¸! ¡Ø!`�à!`�è!@³ð!J³" ¡ "`�("`�0"U³8"v³h"%p"c³x"z³€"礠"ˆ³°"ˆr¸"ˆ³À"“³È"š³Ø"F¢ø"ðr#¸¨#¡³0#±³@#HsH#±³P#ȳˆ#ˆt�#׳˜#ë³Ð#uØ#0wà#ù³ø#F¢$`w $I©($´@$ ¡`$°wh$�p$´ˆ$ ¡¨$x°$�¸$#´Ð$ ¡ð$xyø$`�%9´8%Pz@%G´H%W´€%°zˆ%G´�%g´È%{Ð%˜{Ø%y´&Ø{&‰´ &”´8&F¢X&¢´`&´´h&¹´ &|¨&Ë´°&Ô´è&H|ð&ò¡ø&æ´0'x|8'¤@'ô´H'µh'&¡x'}€'�ˆ'µ�'µÀ'X}È'0µÐ'8µØ'Gµ(È}(0µ(Xµ (jµP(~X(0µ`(~µh(�µ˜(ˆ~ (›µ¨(«µÀ(F¢à(ø~è(�¨ð(ºµ)F¢()00)e¨8)—ªP) ¡p)€x)�€)ɵˆ)Úµ˜) ¡¸)€À)ܧÈ)âµà) ¡*P€*ܧ*ïµ*ùµ(*F¢H*�P*Ö¯X*¶`*¶p* ¡�*X�˜*ܧ *)¶¨*>¶¸* ¡Ø* �à*ܧè*$·ð*T¶+ ¡ +`�(+`�0+ð�8+x®H+ ¡h+‚p+ܧx+^¶€+ž®�+ ¡°+˜‚¸+ܧÀ+²®È+ήØ+ ¡ø+ƒ,ܧ,w¶,‡¶ , ¡@,àLH,ܧP,”¶X,ª¶h, ¡ˆ,pƒ�,ܧ˜,º¶Ð,`�Ø,`�à,˶-`� -`�(-Þ¶`-`�h-`�p-ò¶¨-`�°-`�¸-·ð-`�ø-`�.·. ¡8.`�@.`�H.-·`. ¡€.`�ˆ.`��.E·˜.T·¨. ¡È.`�Ð.`�Ø.e·ð. ¡/؃/ܧ /~·8/ ¡X/`�`/`�h/‹· /(„¨/—·°/±·è/ †ð/Їø/¾·00ø‡80I¨@0зx08ˆ€0d¨ˆ0á·À0€ˆÈ0˜‰Ð0ê·è0ȉø0ò·1ø‰1ò·1ù·01ȉ@1¸P1ø‰X1¸`1¸x1¸ˆ1.¸˜1 ‹ 1.¸¨14¸à10�è1>¸ð1K¸2U¸2ܧ(2Ž02l¸82t¸p2ˆ�x2ƒ¸€2—¸¸2@�À2’È2£¸3H’3ª¸3³¸H3È’P3½¸X3Ô¸�3È’˜3½¸ 3Þ¸Ø3ˆ”à3Ø•è3ð¸ 4–(4ü¸04Þ¦h4H˜p4ü¸x4¹�4 ¡°4™¸4�À4”¶Ø4 ¡ø4`�5`�5œ§@5`�H5`�P5cªh5 ¡ˆ5`��5`�˜5¶°5 ¡Ð5`�Ø5`�à5iªø5 ¡6`� 6`�(6�ž`6`�h6`�p6E·ˆ6 ¡¨6`�°6`�¸6Ò¶Ð6º¥ð6`�ø6`�7ù¶7F¢87`�@7`�H7å¶`7F¢€7`�ˆ7`��7¬¨7 ¡È7`�Ð7`�Ø7L¯ð7 ¡8`�8`� 87­88 ¡X8`�`8`�h8Ý«€8 ¡ 8`�¨8`�°8J­È8 ¡è8`�ð8`�ø8½«9 ¡09`�89`�@9“¨X9º¥x9`�€9`�ˆ9¥žÀ9`�È9`�Ð9›žè9F¢:`�:`�:|§P:`�X:`�È?Ð?#Ø?Sà?Zè?\ @`@@b@Bd`Be€Bfð<ø<==== =(=0= 8= @= H= P= X=`=h=p=x=€=ˆ=�=˜= =¨=°=¸=À=È=Ð=Ø=à=è= ð=!ø=">$>%>&>' >((>)0>*8>+@>,H>-P>.X>/`>0h>1p>2x>3€>4ˆ>5�>6˜>7 >8¨>9°>:¸>;À><È>=Ð>>Ø>?à>@è>Að>Bø>C?D?E?F?G ?H(?I0?J8?K@?LH?MP?NX?O`?Ph?Qp?Rx?T€?Uˆ?V�?W˜?X ?Y¨?[°?]¸?^À?_óúHƒìH‹ÑŸH…ÀtÿÐHƒÄÃÿ5ºœòÿ%»œóúhòéáÿÿÿ�óúhòéÑÿÿÿ�óúhòéÁÿÿÿ�óúhòé±ÿÿÿ�óúhòé¡ÿÿÿ�óúhòé‘ÿÿÿ�óúhòé�ÿÿÿ�óúhòéqÿÿÿ�óúhòéaÿÿÿ�óúh òéQÿÿÿ�óúh òéAÿÿÿ�óúh òé1ÿÿÿ�óúh òé!ÿÿÿ�óúh òéÿÿÿ�óúhòéÿÿÿ�óúhòéñþÿÿ�óúhòéáþÿÿ�óúhòéÑþÿÿ�óúhòéÁþÿÿ�óúhòé±þÿÿ�óúhòé¡þÿÿ�óúhòé‘þÿÿ�óúhòé�þÿÿ�óúhòéqþÿÿ�óúhòéaþÿÿ�óúhòéQþÿÿ�óúhòéAþÿÿ�óúhòé1þÿÿ�óúhòé!þÿÿ�óúhòéþÿÿ�óúhòéþÿÿ�óúhòéñýÿÿ�óúh òéáýÿÿ�óúh!òéÑýÿÿ�óúh"òéÁýÿÿ�óúh#òé±ýÿÿ�óúh$òé¡ýÿÿ�óúh%òé‘ýÿÿ�óúh&òé�ýÿÿ�óúh'òéqýÿÿ�óúh(òéaýÿÿ�óúh)òéQýÿÿ�óúh*òéAýÿÿ�óúh+òé1ýÿÿ�óúh,òé!ýÿÿ�óúh-òéýÿÿ�óúh.òéýÿÿ�óúh/òéñüÿÿ�óúh0òéáüÿÿ�óúh1òéÑüÿÿ�óúh2òéÁüÿÿ�óúh3òé±üÿÿ�óúh4òé¡üÿÿ�óúh5òé‘üÿÿ�óúh6òé�üÿÿ�óúh7òéqüÿÿ�óúh8òéaüÿÿ�óúh9òéQüÿÿ�óúh:òéAüÿÿ�óúh;òé1üÿÿ�óúh<òé!üÿÿ�óúh=òéüÿÿ�óúh>òéüÿÿ�óúh?òéñûÿÿ�óúh@òéáûÿÿ�óúhAòéÑûÿÿ�óúhBòéÁûÿÿ�óúhCòé±ûÿÿ�óúhDòé¡ûÿÿ�óúhEòé‘ûÿÿ�óúhFòé�ûÿÿ�óúhGòéqûÿÿ�óúhHòéaûÿÿ�óúhIòéQûÿÿ�óúhJòéAûÿÿ�óúhKòé1ûÿÿ�óúhLòé!ûÿÿ�óúhMòéûÿÿ�óúhNòéûÿÿ�óúhOòéñúÿÿ�óúhPòéáúÿÿ�óúhQòéÑúÿÿ�óúhRòéÁúÿÿ�óúhSòé±úÿÿ�óúhTòé¡úÿÿ�óúhUòé‘úÿÿ�óúhVòé�úÿÿ�óúhWòéqúÿÿ�óúhXòéaúÿÿ�óúhYòéQúÿÿ�óúhZòéAúÿÿ�óúòÿ%—Dóúòÿ%ý–Dóúòÿ%õ–Dóúòÿ%í–Dóúòÿ%å–Dóúòÿ%Ý–Dóúòÿ%Õ–Dóúòÿ%Í–Dóúòÿ%Å–Dóúòÿ%½–Dóúòÿ%µ–Dóúòÿ%­–Dóúòÿ%¥–Dóúòÿ%�–Dóúòÿ%•–Dóúòÿ%�–Dóúòÿ%…–Dóúòÿ%}–Dóúòÿ%u–Dóúòÿ%m–Dóúòÿ%e–Dóúòÿ%]–Dóúòÿ%U–Dóúòÿ%M–Dóúòÿ%E–Dóúòÿ%=–Dóúòÿ%5–Dóúòÿ%-–Dóúòÿ%%–Dóúòÿ%–Dóúòÿ%–Dóúòÿ% –Dóúòÿ%–Dóúòÿ%ý•Dóúòÿ%õ•Dóúòÿ%í•Dóúòÿ%å•Dóúòÿ%Ý•Dóúòÿ%Õ•Dóúòÿ%Í•Dóúòÿ%Å•Dóúòÿ%½•Dóúòÿ%µ•Dóúòÿ%­•Dóúòÿ%¥•Dóúòÿ%�•Dóúòÿ%••Dóúòÿ%�•Dóúòÿ%…•Dóúòÿ%}•Dóúòÿ%u•Dóúòÿ%m•Dóúòÿ%e•Dóúòÿ%]•Dóúòÿ%U•Dóúòÿ%M•Dóúòÿ%E•Dóúòÿ%=•Dóúòÿ%5•Dóúòÿ%-•Dóúòÿ%%•Dóúòÿ%•Dóúòÿ%•Dóúòÿ% •Dóúòÿ%•Dóúòÿ%ý”Dóúòÿ%õ”Dóúòÿ%í”Dóúòÿ%å”Dóúòÿ%Ý”Dóúòÿ%Õ”Dóúòÿ%Í”Dóúòÿ%Å”Dóúòÿ%½”Dóúòÿ%µ”Dóúòÿ%­”Dóúòÿ%¥”Dóúòÿ%�”Dóúòÿ%•”Dóúòÿ%�”Dóúòÿ%…”Dóúòÿ%}”Dóúòÿ%u”Dóúòÿ%m”Dóúòÿ%e”Dóúòÿ%]”Dóúòÿ%U”Dóúòÿ%M”Dóúòÿ%E”Dóúòÿ%=”Dóúòÿ%5”DIƒÈÿé7A€óúAWAVAUATI‰ôU‰ýH�=')SH�ì¨dH‹%(H‰„$˜1Àè‡YL‰æ‰ïè]T‹Ó–H‹P–H‹5)”D‹-º—‰Ø÷ØEäƒûí1ÿèOþÿÿƒåH‰Å–ƒíH…À„ÂÇ·–èÊþÿÿH‹=C–¾èYýÿÿèüÿÿ¿èZüÿÿèUûÿÿ1ÿè®ùÿÿ…Û…º1ö¿1Ûè³þÿÿ‰îD‰â¿è¤þÿÿº¾¿è�þÿÿD‰â¾¿è~þÿÿD‰â¾¿èlþÿÿº1ö¿è[þÿÿº1ö¿èJþÿÿD‰â¾¿è8þÿÿD‰â¾¿ è&þÿÿD‰â¾¿ èþÿÿD‰ï½€è'H�D$PfïÀH‰D$8H�D$HH‰D$0)D$`�ý‡®èÉøÿÿI‰ÀHcÃI‹ƒ<‚H„6ƒã߃ûR„²H‹|$81öE1äè ýÿÿH‹-앾H‰ïè÷úÿÿ¾H‰ïèZúÿÿH‰ïè¢øÿÿH‹=Õ1Ò1öL�¯ðH� �ò1ÀèúÿÿH‹\$0H‰ßèÅúÿÿH‰ßH�•èùÿÿH‹=‡•H�5õîH‰Â1ÀèNùÿÿH‹=o•èbúÿÿH‹=C•è6øÿÿë]@àÇôƒè‡H�5+àH�==àètH�5:àH�=PàèaH�5HàH�=^àèNH�5VàH�=hàè;H�5Ì_H�=[àè(H�5é_H�=MàèH�5EàH�=MàèH�5HàH�=RàèïH�5LàH�=[àèÜH�5Å_H�=OàèÉH�5Ú_H�=Aàè¶H�5ï_H�=>àè£H�5ü_H�=0àè�H�5!`H�= áè}H�5F`H�=éèjH�5s`H�=ìÝèWH�5ˆ`H�=éßèDH�5•`H�=âßè1H�5ÛßH�=òßèH�5Ÿ`H�=ãßè H�5´`H�=ÕßèøH‹=!‚è èÿÿH‹=í‚èàåÿÿH‹=á‚1Ò¾èÝçÿÿH‹=΂1Ò1öH� ˜ß1Àè4çÿÿH‹=µ‚1Ò¾è±êÿÿH‹=¢‚èµçÿÿDH‹=¹�èÄæÿÿƒøÿtï=š„€ûÿÿé•ìÿÿ€H‹É‚Hƒú†}ìÿÿ‹ ƒøÿ„‚�HH9ÊH‰ÈºÿÿÿÿF‰í~éRìÿÿ@H‹ ‰‚H…Ét'H‹5u‚1Ò1À�H�€H�€ÇDÆx�BH‰ÂH9ÈråÇO�é ìÿÿHÇD$ÇD$é™õÿÿè»éÿÿéàêÿÿÇx~éÝëÿÿH� Ø÷ºŸH�5\NH�=?ßèæÿÿº&H�5¤÷¿èòè=çÿÿº‹H�5™÷¿è×H‹ p€º¾H�=ÆÜèjéÿÿ¿èPçÿÿóú1íI‰Ñ^H‰âHƒäðPTE1À1ÉH�=qéÿÿÿ›}ôf.„H�=É}H�Â}H9øtH‹~}H…Àt ÿà€Ã€H�=™}H�5’}H)þH‰ðHÁî?HÁøHÆHÑþtH‹M}H…ÀtÿàfDÀóú€=Íu+UHƒ=}H‰åt H�=îè9äÿÿèdÿÿÿÆ¥]ÃÀóúéwÿÿÿ€óúòOòF¸f/Áw 1Àf/È—À÷ØÃff.„USHƒì‹ l€…Ét11ÛH�-W€€H‹U‰ØƒÃH�@H�ÂH‹8èçåÿÿ;9€rßHƒ=?€tB1í1À�H�€H�€H‹!€HÁãH‹|è³åÿÿH‹ €H‹|è¢åÿÿ�EH;€H‰ÅrÃH‹=Üè‡åÿÿHÇÌHÇÉHƒÄ[]Ãf.„H…ÿ„ÊATI‰üUSL‹G@M…Àt7I‹8H…ÿt&»f.„è+åÿÿM‹D$@I‹<HƒÃH…ÿuéL‰Çèåÿÿ�I‹l$0H…ít6Hƒ}tgH‹}èöäÿÿH‹}èíäÿÿH‹}èääÿÿH‹]0H‰ïèØäÿÿH‰ÝH…íuÊI‹<$èÇäÿÿI‹|$è½äÿÿI‹|$è³äÿÿI‹\$8L‰çè¦äÿÿH…ÛtI‰ÜëŒ@H‹m0ë‡[]A\ÃÃff.„�HƒìH‹=�~H…ÿtèKåÿÿHLj~H‹=y~H…ÿtè/åÿÿHÇd~H‹=U~H…ÿtèåÿÿHÇ@~H‹=1~H…ÿtè÷äÿÿHÇ~H‹= ~H…ÿtèÛäÿÿHÇø}HƒÄÃff.„€>„áAUATI‰üUSH‰óHƒì€1Ò¾L‰çèÁâÿÿ¶+@„ít8è$ãÿÿI‰Åë€@¾õHƒÃL‰çèåÿÿ¶+@„ítI‹UH¾ÅöDBtÙ1Ò¾L‰çèråÿÿ1Ò¾ L‰çècâÿÿ¶+@„ít2èÆâÿÿI‰Åë�@¾õHƒÃL‰çèÀäÿÿ¶+@„ítI‹UH¾ÅöDBuÙ1Ò¾ L‰çèåÿÿ€;…AÿÿÿHƒÄ[]A\A]ÃÃDAWAVAUE‰ÍATUH‰ýSD‰ÃHƒìE…À„€D‰À)ÊA¾$�ÒÑè��1ÒA÷ð1ÒA‰ÀA‰Ç�ÉÁà÷óA‰ÄA�@E)æE)ƃø&‡¯C�Dƒø&‡¡ºD‰D$ èuãÿÿD‹D$ ƒøÿ…1Ò¾ H‰ïèháÿÿM…ÿt1Û�¾|H‰ïHƒÃèÏãÿÿL9ûuê1Ò¾ H‰ï1Ûè9äÿÿ1Ò¾ H‰ïè*áÿÿM…ätD¾|H‰ïHƒÃè�ãÿÿL9ãuê1Ò¾ H‰ï1ÛèùãÿÿM…öt@¾ H‰ïHƒÃè_ãÿÿI9Þuê¾] H‰ïèMãÿÿH…í„”Aƒå„ŠD¿m¿MD‰èf Èxy1ÀD�aþƒùD‰îDNàH‰ïD‰âè~âÿÿƒøÿuiH‹=¢zHƒÄD‰âD‰î[]A\A]A^A_éYâÿÿf„ºE1äA¾$è=âÿÿƒøÿt8¾[ H‰ïA‰ßè¸âÿÿé¼þÿÿHƒÄ[]A\A]A^A_Ã�¾> H‰ïè“âÿÿëˆ�1Ò¾ H‰ïèàÿÿé²þÿÿ@D‰Ãë«H� Äñº™H�5ˆGH�=¹Gè4ßÿÿ@PXH� ·ðº–H�5cGH�=ÓHƒìè ßÿÿff.„PXH�HHƒìƒÿt-H�Óƒÿt!H�ÛGƒÿtƒÿH�ÝÒH� ¥GHEÁH‰ÊyH‰5»y‰±yèHàÿÿ„AWAVAUATUSHƒìH‹KyH…À„¢¿P¿h�J�]ƒúþ„‹ƒûÿ„‚; xzu 9lz„àH‹=Wz‰ ]zD�m‰OzèÂßÿÿH‹=3zè¶ßÿÿL‰ïè.àÿÿH‰'zI‰ÄH…À„‚L‰ïèàÿÿH‰zH‰ÅH…À„QH‰ÚM�<L�tL‰çH�52GèuÝÿÿH‰ÚH�5KGH‰ïècÝÿÿAÆL‰çAÆèÝÿÿI�<I9ÿvH‰Ú¾ H)ÂèZÝÿÿH‰ïèòÜÿÿH�|I9þvH‰Ú¾ H)Âè8ÝÿÿHƒ=hywHƒÄ[]A\A]A^A_ÀH‹=yèÜÞÿÿL‰ïèTßÿÿH‰ýxH‰ÅH…À„|H‰ÚH�5ïFH‰Çè¿ÜÿÿL�dH‰ïAÆ$èmÜÿÿH�|I9üv•HƒÄH)þ H‰Ú[]A\A]A^A_é¥ÜÿÿDH‹ ywHƒÄº¾[H�=ñÐ]A\A]A^A_éeàÿÿºóH�5*ï¿èŸýÿÿºäH�5ï¿è‰ýÿÿºâH�5þî¿èsýÿÿS‰ûèÈýÿÿèsùÿÿ‹uxE1À1ÉH‹=w¾è7Ûÿÿ�sE1À¹‹NxH‹=ïvH‰àwèÛÿÿ‹5x�KE1ÀH‰°w‹&xH‹=Ãv�pý)Þ‰5ˆwèãÚÿÿ‹xE1ÀH‹=£vH‰„w‹òw¾�Hÿè¹Úÿÿº)¹H‹=`wH‰Iw‹Ãw¾D�@×èýÜÿÿH‹=VvºÿÿÿÿH‰:wH…ÿt¿WƒÂ¹1öèrÝÿÿH‹=+vèöÙÿÿH‹=vè ÜÿÿH�žÏfïÀHÇÌvH‰}vH�ŠÏH‰wvH�…ÏH‰qvrv{v„vƒû~H�pÏH‰QvH�uÏH‰Kv[Ãf„óúPXº?H�5°ì¿HƒìèÀûÿÿAUI‰õATUSH‰ûH�ìØH‰T$0H‰L$8L‰D$@L‰L$H„Àt7)D$P)L$`)T$p)œ$€)¤$�)¬$ )´$°)¼$ÀdH‹%(H‰D$1ÀH�„$Hƒ=ÞuÇ$H‰D$H�D$ ÇD$0H‰D$„ò‹,vD�`L‰çèÜÿÿH‰ÅH…À„òL‰â¾ H‰Çè¬ÙÿÿL‰æH‰ïI‰áM‰èHÇÁÿÿÿÿºèÚÿÿ¾ H‰ïèòÚÿÿH…ÀtÆ H‰ïèÙÿÿH‹=Ku1Ò¾ ÆD ‹±uÆDè/Úÿÿ‹s0I‰è1ÒH‹= uH� ¦Î1Àè‚ÙÿÿH‹= u1Ò¾ èÿÜÿÿH‹=øtèÚÿÿH‰ïèÛÚÿÿH‹D$dH+%(u,H�ÄØ[]A\A]ÃDH‹=�qH‰áL‰ê¾èá×ÿÿëÄèZÚÿÿºH�5fë¿èôùÿÿ@ATSHƒìèDÜÿÿI‰ÄH…Àt'1Û€8[H‰Çu ëPƒÃH�x¾:èß×ÿÿH…ÀuêƒûtHƒÄL‰à[A\Ãf.„L‰ç¾:è³×ÿÿÆHƒÄL‰à[A\ÃD¾]è–×ÿÿH…Àt&ÆI�|$èÄÛÿÿL‰çH‰ÃèéÙÿÿI‰ÜHƒÄL‰à[A\ÃL‰çE1äèÐÙÿÿë‰ff.„AUATUSHƒìH…ÿ„ÅI‰ôH…ö„¹H‰ûèi×ÿÿL‰çH‰Åè^×ÿÿ¾:H‰ßHÅè×ÿÿH…ÀtiHƒÅ¿H‰îèø×ÿÿI‰ÅH…ÀtxH�[ÌL� VÌHƒìH‰îL‰ïºATL�@ÌHÇÁÿÿÿÿP1ÀSèz×ÿÿHƒÄ L‰èHƒÄ[]A\A]ÄHƒÅ¿H‰îè�×ÿÿI‰ÅH…ÀtH�ÍI‰Áë™HƒÄE1í[L‰è]A\A]ÀAWAVAUATUH‰õSH‰ûH�ìèdH‹%(H‰„$Ø1ÀHÇD$èhÚÿÿH…À„ŸÇE€;/I‰Ä…L1Ò¾¿è›ÕÿÿA‰Ç…Àˆ7¸H�|$bºkH‰Þf‰D$`L�l$`èOÖÿÿH‰ÚH‰ï1ÀH�5LËÆ„$ÍèÓûÿÿºnL‰îD‰ÿèóÖÿÿ…À…šE1öE1íD‰}H�}1öè6Ùÿÿ‹}H�L$ A¸º¾HÇD$ HÇD$(è‡ÙÿÿH‹}H9ßt,H…ÿt è´×ÿÿHÇEM…íH�5²ÊL‰÷IEõèÖýÿÿH‰EH‹|$E1ÿH…ÿtèà×ÿÿL‰çèx×ÿÿM…ötL‰÷èk×ÿÿM…ítL‰ïè^×ÿÿH‹„$ØdH+%(…RH�ÄèD‰ø[]A\A]A^A_Ãf�1öH‰ßè¦Øÿÿ…À„¢þÿÿfïÀH‰ß)D$0)D$@ÇD$8ÇD$0)D$PèsüÿÿI‰ÆH…À„ŠH‰ßè_üÿÿI‰ÇH…À„›H‰Çè›Ôÿÿ1Ò€;[”ÂH�ÈéˆþÿÿH�=7Èè Ôÿÿ뾉Çè¤ÕÿÿL‰ùL‰òH‰ïI‰ÀH�5a=1Àèªøÿÿé3ÿÿÿè°ÔÿÿºžH�5¤å¿èJôÿÿf.„ATUHƒìH…ÿt+D‹'E…ä~#H‰÷H‰õè�ÒÿÿH‰îD‰ç1ÉH‰Âè‘ÒÿÿHƒÄ]A\ÃH� 2åº8H�5>;H�=ÉÇèêÒÿÿf.„óúAUATUSHƒì‹ôm…Òt3H‹=YnH…ÿtèGÑÿÿH‹=Hnè[Óÿÿè¶ïÿÿèÕÿÿH‹=ºmèUÕÿÿ1í1ÀL�%yÇHƒ=znÇ mtwfDH�ÅH‹=anH)ÃL�,ÝLÀƒøv!L‰æèÿÿÿH‹:n‹<ØèòÕÿÿH‹=+nLïH‹(è¯ÓÿÿH‹nJ‹|(èžÓÿÿ�EH;ümH‰År�H‹=èmèƒÓÿÿH‹=ìmèwÓÿÿH‹=ðmèkÓÿÿHƒ=Ëmv H‹=ŠmèUÓÿÿH‹=ÆmèIÓÿÿ‹Ël…ÀtHƒÄ[]A\A]Ã@H‹ 9lº¾H�=}Æè3ÕÿÿH‹ ŒlH…ÉtH‹=lH�?ʾ1Àè]ÔÿÿH‹ ^lH…ÉtH‹=êkH�Uƾ1Àè7Ôÿÿ‹ 5l…ÉuH‹5ÆkHƒÄ¿ []A\A]éÒÒÿÿf�H‹=©kH�ƾ1ÀèöÓÿÿëÇ@H…ÿtSUH‰õSH‰ûHƒì€H‹;H…ÿt H‰îèÓÿÿ…Àt"H‹{H…ÿt H‰îèóÒÿÿ…Àt H‹[8H…ÛuÎ1ÀëH‰ØHƒÄ[]Ã1ÀÃDATI‰üSHƒìH…ÿt>H‰ófDI‹<$H…ÿt H‰Þè§Òÿÿ…Àt I‹|$H…ÿt H‰Þè‘Òÿÿ…Àt M‹d$8M…äuËHƒÄL‰à[A\ÄAUI‰ÍATI‰ôUH‰ÕSHƒìèˆÿÿÿH…À„ý‹P$H‰Ã‹@(ƒàuY…ÒuCH‹{H…ítèÑÿÿH‰ïèGÓÿÿH‰CH‰ÇH…À„ìL‰kÇC$H…ÿ„‹ÇC 1ÀHƒÄ[]A\A]À…Òt§¾H¿èµÏÿÿI‰ÄH…À„ðH…ítH‰ïèÜÒÿÿI‰D$H…À„¨M‰l$H‰ØfDH‰ÂH‹@0H…ÀuôH‹{L‰b0ÇC$H…ÿ…yÿÿÿ@H‹CHƒÀHƒø‡cÿÿÿÇC HƒÄ1À[]A\A]ÃH‹=«iL‰á¾1ÀH�"9èõÑÿÿ¸ÿÿÿÿé1ÿÿÿH‹ „iº"¾H�=+9è~ÒÿÿƒÈÿé ÿÿÿH‹ _iº"¾H�=9èYÒÿÿL‰çè1ÐÿÿƒÈÿéßþÿÿH‹ 2iº"¾H�=9è,ÒÿÿƒÈÿéºþÿÿ@AT1ÒI‰ô¾ SH‰ûHƒìH‹=ièðÎÿÿ‹5BiI‰Ø1ÒH‹=þhH� \Ã�F‰&i1Àè7ÎÿÿH‹=àh1Ò¾ è´ÑÿÿH‹=ÍhHƒÄL‰â[H�5)Ã1ÀA\é…ÍÿÿDAWI‰×AVAUATUH‰õS‰ûH�=ÃHƒì(è~ÏÿÿH…À„µ1ÀA½+¿+‹5¢hD‹%óeHLjh…ö„IcÔH˜H‹|ÕL�ÕHcÖLøD¾4D‰5Th¶„Òu]D‹¦e…À…ªƒÆA¾?‰5;hHcö€<7„fDD9ã}‰ueHƒÄ(D‰ð[]A\A]A^A_ÃHƒÀ„Òt¨¾Ê¶PA9ÎuìƒÆ‰5ëg€ú:tAƒþW…¤€ú;…›HcÖHú€:…8€x:„OǰgA�D$‰ýd9،ߋëd…Ò…E1öA€ý:A‰ÄA•ÆG�t¶:éOÿÿÿ€D9ãŽÅIcÄH‹TŶ €ù-„ó@€ÿ+„™@€ÿ-uéöfDHƒÀ9ÃŽ|H‹TŶ A‰Å€ù-uä€ztÞL‰úH‰î‰ß‰`dè#þÿÿA‰ÆE9åŽ÷HcHdIcÍH�t͉D$I‰ÁH‰D$ëOf.„A�AÿH�~øL‰L$)ÈH‰ $H�Åè ÎÿÿH‹ $L‹L$H‰ÇHƒéN‰|ÍøH‰þIƒéA9Ì�›L‹~øA9ɲH�~øëØH‹MH‹=!fE‰ð1À¾H�6A¾:èeÎÿÿ‹5OfD‹% cA€ý:t A¾?@…ö„þÿÿIcÄHcöH‹DÅ€<0…óýÿÿÇfAƒÄD‰%^céÙýÿÿ�E¶/1ÒA€ý:”À”¶ÀA¶<‰Ð�OÕ�áý…/ýÿÿƒÀA€ý:„"ýÿÿHcȃÂE¶,A€ý:DÂé ýÿÿA¾ÿÿÿÿéˆýÿÿDH‹=IeH‹ME‰ð1À¾H�Ô¿è�ÍÿÿHcÐb‹5reH‹|ÅI‰ÄéýÿÿD¶r@€þ-t6@„ö„úýÿÿë1AƒÄH‰5eA¾D‰%ˆbÇ&eéùüÿÿ�€ztxL‰úH‰î‰ßÇeè#üÿÿA‰ÆD‹%QbéÌüÿÿ@D‰àE‰èH‹t$E)ìA)ÀDd$A�@ÿH�TõøD‰%"bH÷ØL‰<Âé–üÿÿJ‹DAƒÄD‰%bH‰ŸdézüÿÿAƒÄA¾ÿÿÿÿD‰%éaédüÿÿAƒÄH‰ydD‰%ÒaÇpdéCüÿÿ…ö…Hþÿÿé6üÿÿff.„AWAVA¾+AUI‰ÍATUH‰õS‰ûH�=q¾HƒìhH‰T$L‰D$èÞÊÿÿ¾+H…À„XD‹%aaHÇöcA9Ü� IcÄL‹|ÅH� ÅH‰L$A¶€ú-„s@€þ+„Y@€þ-u é–fDHƒÀ9ÃŽ<L‹|ÅA¶A‰Æ€ú-uãA€tÜL‹D$H‹T$L‰éE1ÉH‰î‰ß‰Ñ`è$ÿÿÿA‰ÅE9ô�Hc¹`Mcþ‰\$$D‰l$J�tý‰D$H‰ÃH‰D$ë5f��CÿH�~øD)øH�ÅèËÿÿH‰ÇIƒïL‰lÝøH‰þHƒëE9ü� L‹nøD9ûÄH�~øëØfDA€…&DA�D$A½ÿÿÿÿ‰/`9Ã}‰%`HƒÄhD‰è[]A\A]A^A_ÃH‹L$D¶1A€þ:”À”¶À¶4�FÕ¨ý…ƒþÿÿA€þ:„yþÿÿH�BƒàD¶4éhþÿÿ„A½ÿÿÿÿ뛄A¶@€ÿ-„Yÿÿÿ@„ÿ„uþÿÿH‹T$H‰î‰ßèYùÿÿA‰Å‹ˆ_éTÿÿÿE�\$L‰=bA½D‰g_é=ÿÿÿf.„D‰àH‹L$M‰è‹\$$D)ðE)æD$D‹l$A�VÿH�LÍø‰+_H÷ÚL‰ÑéðþÿÿÇ­a-1ÀA€-”À”ÁI�D¶ÉH‰D$@¶ƒÁ‰L$$ˆD$2„À„8€|$2=„-‹D$$ƒÀH˜ë €€ú=tA¶‰ÁHƒÀ„Òuì‰L$LˆT$2I‹}H‰|$PH…ÿ„û‹D$L+D$$A¹Dˆt$3H˜D‰d$4I‰ü‰\$HI‰ÆD‰ËH‰l$8H‹l$@H‰D$XL‰|$(ëDHcÃHÁàM‹dM…ä„£ƒÃL‰çD�{ÿèLÅÿÿL9ðu×L‰òH‰îL‰çèIÅÿÿ…ÀuÅD‰þD¶t$3L‹|$(D‹d$4‹\$HH‹l$8HcÖHÁâLê€|$2=‹B„…ƒø„ÓH‹D$‰0H‹BH…À„¯‹RE1í‰D‹%½]A�D$‰²]é~ýÿÿ‹D$$‰D$LéôþÿÿD¶t$3L‹|$(1ö1ÉD‹d$4‹\$HM�M 1ÀH‹l$8H‹|$PDˆt$3L‹t$XL‰|$(A‰ÇD‰d$4L‹d$@‰\$H‰óH‰l$8‰ÍL‰l$@M‰Í€L‰òL‰æè]Äÿÿ…ÀuAƒÇ‰ëI‹}IƒÅ ƒÅH…ÿuÛD‰ø‰ÞD¶t$3L‹|$(D‹d$4‹\$HH‹l$8L‹l$@ƒø„îþÿÿ…ÀtL‹á\A½?…À„²üÿÿE�\$H‹MM‰øH�ô¹D‰½\H‹=_¾1ÀèbÇÿÿ‹¤\épüÿÿƒ|$$„ôüÿÿ‹Š\A½?…Ò„[üÿÿE�\$H‹MM‰øH�¹D‰f\ë§…À…ª‹5R\A½?…ö„‹þÿÿL‹H‹MH�Â.¾H‹=†^èáÆÿÿD‹%"\é`þÿÿD‹jD‹%\éPþÿÿAƒÄD‰%\D9ãcE1í‹ ð[A€þ:A•ÅG�l­:…É„"þÿÿL‹H‹MH�‰.1ÀH‹= ^¾èvÆÿÿD‹%·[éõýÿÿ‹D$LƒÀH˜LøH‰?^éºýÿÿH‹D$H‹DH‰)^é¤ýÿÿff.„�AWAVAUATUSH�ìHƒ $H�ìèL�54÷E1ÉE1í1íH‰|$‰t$4H‰T$8‰L$(dH‹%(H‰„$Ø1ÀÆD$p:HÇD$ ÇD$0ÇD$,é@‹D$(A#F,L‰ $„õA‹F(¿HI‹^M‹&‰D$I‹F H‰D$è”ÄÿÿI‰ÇH…À„ÄL‹ $M…É„[L‰ÏèÃÅÿÿI‰H…À„›M…ä„L‰çè¦ÅÿÿI‰GH…À„uH‹D$H…À„ H‰ÇèƒÅÿÿI‰GH…À„Ô ¸I‰_HƒÃ¹HƒûIÇG0CÁIÇG8AÇG$A‰G ‹D$A‰o,A‰G(IÇG@M…í„ÄHƒ|$M‰}8M‰ý„ÎM‹N@ƒÅIƒÆHM…É…åþÿÿIƒ>…ÛþÿÿH‹|$H…ÿ„/H�5§¿èéÂÿÿH‰ÅH…À„ÒA½E1äHƒ|$…hH‹t$8‹|$4L�t$pH�Œ$E1ÉL�D$DL‰òÇD$DèÊ÷ÿÿ‰Ãƒøÿ„±ƒø:„¦ …À„‹‰ÆL‰÷è$ÀÿÿH…À„b ‹L$,…É„] H�”$(1ÀëƒÀHƒÂ 9Á„? 9uíH˜HÁàL‹¼€M…ÿ„ L‹5�[H‹|$ L‰þè ðÿÿH…À„îHcP,H�=§ôH�ÒH�×öC5„H‹L$H‹= [H…É„ÌI‰ÈH‹E‰á¾H�Ã-1ÀèDÃÿÿéÛþÿÿ€H‹D$IÇGH…À…÷ýÿÿIÇG1ÀéþÿÿHÇé­ýÿÿ@H‹D$ Hƒ|$L‰|$ M‰ýI‰G8…2þÿÿM…ä„ê�|$,•�õHcD$,H‰ÆHÁæL‰¤4¾öD$uAƒ~ ¾tHƒ|$¾ƒÞÿA¾~HÁà‰´HÇ„ ‰þ‰¼(‹D$,ƒÀ‰D$,@„öt]�|$0“�áHc|$0Aƒ~ @ˆtÿàèºÿÿÇH‰$M…ö„1ÒH�t$HL‰÷è$ºÿÿL‹ $I‰ÀAƒ9"„©H‹D$H¶„É„rƒéG€ù&wAHº¸HÓàH…Ð…Hº@@H…Ð…%HºH…Ð…DHƒ|$H‹=ÝU….D¾CH‹KE„À„H�Î*¾1Àè¾ÿÿéeþÿÿE1ÀM…ötL‰÷º 1öE1öèC½ÿÿLcÀH‹|$ L‰ÁL‰òL‰þè­êÿÿ…À‰qùÿÿHƒ|$H‹=hU„dL‰ùH�x+¾1À謽ÿÿéÿýÿÿM…ö„ñIƒÈÿHƒ|$u¢A€>uœD¾CH‹KH‹=UE„À„:H�d)¾1Àè`½ÿÿé³ýÿÿH�5°L‰÷èl»ÿÿ…À„lH�5‡ºL‰÷èu¼ÿÿ…À… E1öA¸é/ÿÿÿ„OýÿÿHcÒAÆA€>"…_ùÿÿI�^¾"H‰ßè&»ÿÿH…À„‚ÆA€~„JI‰Þé/ùÿÿH‹ pTº)¾H�='%èj½ÿÿH‹|$ èàÕÿÿHÇD$ éûÿÿE1öA¸é¤þÿÿD¾CH‹KE„ÀtMH�/'¾1Àès¼ÿÿéøÿÿH‹ Tº*¾H�=î$è½ÿÿH‹|$ èwÕÿÿHÇD$ éµúÿÿH�'¾1Àè&¼ÿÿéÉ÷ÿÿL‰÷H�5Ú®è2ºÿÿE1À…ÀA”ÀE1öéþÿÿAÇ"Hƒ|$H‹=�S„HL‰ùH�)1ÀE1öI¸ÿÿÿÿÿÿÿ¾èÄ»ÿÿI¸ÿÿÿÿÿÿÿéÅýÿÿE1Àé½ýÿÿL‹s(éþÿÿH‹D$H…À„îûÿÿH‹=/SH‰ÁM‰ùE‰àH�Ç%¾1Àès»ÿÿéÆûÿÿH…ítH‰ïèa¹ÿÿHƒ|$ „ÑùÿÿHc–P9\$4ŽÀùÿÿ‹|$4¾)߃ÇHcÿèN¸ÿÿH‰ÅH‹D$ H‰h@H…í„OD‹d$4L‹l$8ëHƒÃHƒÅA9ÜŽxùÿÿI‹|ÝèR»ÿÿH‰EH…ÀuÜH‹ ‚Rº¾H�=)è|»ÿÿé,ûÿÿH‹ `Rº1¾H�=w#èZ»ÿÿH‹|$ èÐÓÿÿHÇD$ éùÿÿH‹=+R¾Ë¾1ÀH�‚$èuºÿÿéÈúÿÿH‹ Rº3¾H�=($è»ÿÿé¦úÿÿH…í„ÁøÿÿH‰ïè=¸ÿÿé´øÿÿH¸ÿÿÿÿÿI9À�$þÿÿIÁàE1öM…À…%üÿÿI¸ÿÿÿÿÿÿÿéüÿÿH¸ÿÿÿÿI9À�òýÿÿIÁàëÌHƒ|$H‹=€Q„ìL‰ùH�(%¾1ÀèĹÿÿéúÿÿH‹KH‹=TQM‰ø1ÀH�¸$¾èž¹ÿÿéñùÿÿH‹ 2Qº¾H�="¬è,ºÿÿéÏùÿÿH‹L$H‹= Q¾H�_"èZ¹ÿÿé­ùÿÿH¸ÿÿÿÿÿÿI9À�AýÿÿIÁà éÿÿÿH�j%¾1Àè&¹ÿÿéyùÿÿH� &¾1Àè¹ÿÿéaùÿÿL‰ùH�w%¾1Àèó¸ÿÿéFùÿÿD¾CH‹KE„À„¸H�]$¾1ÀèɸÿÿéùÿÿH‹L$E‰àH‹=UPH�Þ!¾褸ÿÿé÷øÿÿD¾CH‹KE„À„�I¹ÿÿÿÿÿÿÿH�ì%¾1Àèp¸ÿÿE1öI¸ÿÿÿÿÿÿÿénúÿÿH‹KH�C&¾1ÀèG¸ÿÿéšøÿÿI‹èɶÿÿI‹?èÁ¶ÿÿL‰ÿè¹¶ÿÿépöÿÿH�Ý#¾1Àè¸ÿÿédøÿÿI¸ÿÿÿÿÿÿÿH�#%¾1Àèï·ÿÿE1öI¸ÿÿÿÿÿÿÿéíùÿÿè(¶ÿÿE1öA¸éÚùÿÿH‹ cOº¾H�=Ò%è]¸ÿÿH‹|$ èÓÐÿÿHÇD$ éöÿÿL‹D$E‰áL‰ù¾H‹=OH�!1Àèp·ÿÿéÃ÷ÿÿL‹D$E‰áL‰ù¾H‹=ôNH�­ èH·ÿÿé›÷ÿÿAVAUATUSH…ÿ„‡H‰ý‹?ƒÿÿ„…ÿŽ�I‰öA¼ÿëRfDI‰ÄM)ôIƒÄ„óL9ã‚ ‹}1ÉL‰âL‰ö迲ÿÿHƒøÿtYH…ÀŽ I9Ä…IÆM…íuL‹}¹L‰âL‰ö茲ÿÿH‰ÃH…À~DH‰Ú¾ L‰÷èÔ´ÿÿI‰ÅH…Àu„I‰Ü똀H‰ïè8 M…ít´AƸ[]A\A]A^Ã�英ÿÿ‹8èT²ÿÿH‹UH‰ïH�5ä©H‰Á1Àè|ØÿÿH‰ïH�5!¨èíßÿÿ‹}èå¶ÿÿÇEÿÿÿÿ1À[]A\A]A^Ã[1À]A\A]A^ÃH� vĺtH�5:H�=¸¨èæ²ÿÿH� WĺuH�5H�=¡¨èDzÿÿH� 8ĺzH�5üH�= $訲ÿÿH� ĺZH�5ÝH�=V¨è‰²ÿÿH� úú`H�5¾H�=Q§èj²ÿÿf.„AWAVAUATI‰üUH‰õSH�ìX‹‰T$dH‹%(H‰„$H1ÀH�¨…ÿtI‹D$I‹|$(H‰EH…ÿ„¡¾ è#±ÿÿI‰ÆH…À„¿H¾„Û„èö²ÿÿH‹L‰ðëfDH¾XHƒÀ„Ût öDZtì¶I9Ærë f.„€û-tHƒè¶I9ÆtöÃßuê„Û„ ¶PL�xM‰ýöÂß„<ƒâý€ú-ué/��âßtL‰îA¶UIƒÅ‰Ñƒáý€ù-uâH)ÆH‰óH�~èS³ÿÿH‰EH…À„ÞL‰þH‰ÇH‰Ú舱ÿÿ¾/L‰ïÆè7°ÿÿH…À„L�h¾/L‰ïè°ÿÿH‰ÃH…À„hI‰ßM)ïI�èò²ÿÿH‰EH…À„gL‰îL‰úL�mH‰Çè#±ÿÿBÆ8€;…?fïÀEIÇE0AEAE ‹­Lƒû=vL‹mL‰ïèä¯ÿÿI‰À�CÃI9À‡þL‰uP1öH�|$0H�\$@L�5N¥è)³ÿÿH‹D$0fïÉI+D$òH*ÈH‹T$8fïÀI+T$ òH*¾‰ˆˆˆH‰D$0ò^©ÂH‰T$8ºÅ³¢‘ÇElòXÁHÇEpÇE|Æ„$@òH,ÈÇD$‰ÈH¯ÐH¯ÆHÁê+HÁè%ˆU\‰ÂH¯Ö‰ÆkÀ 0 && (size_t)nread == len heap %lfM mmap %lfM used %lfM free %lfM releasable %lfM pools %u pools_used %lfM pools_total %lfM heap N/A mmap N/A used N/A free N/A releasable N/A pools %u pools_used %lfM pools_total %lfM!stats->prim_max && "There can be only one primary pool!"ERROR: Can't parse command line options Clam AntiVirus: Monitoring Tool %s By The ClamAV Team: https://www.clamav.net/about.html#credits (C) 2024 Cisco Systems, Inc. clamdtop [-hVc] [host[:port] /path/to/clamd.sock ...] --help -h Show this help --version -V Show version --config-file=FILE -c FILE Read clamd's configuration files from FILE --defaultcolors -d Use default terminal colors host[:port] Connect to clamd on host at port (default 3310) /path/to/clamd.sock Connect to clamd over a local socketClam AntiVirus Monitoring Tool %s Can't parse clamd configuration file %s Can't strdup LocalSocket value Can't find how to connect to clamd __ ____ _____/ /___ _____ ___ ____/ / /_____ ____ / ___/ / __ `/ __ `__ \/ __ / __/ __ \/ __ \/ /__/ / /_/ / / / / / / /_/ / /_/ /_/ / /_/ /\___/_/\__,_/_/ /_/ /_/\__,_/\__/\____/ .___/ /_/Maximum number of items observed in queueTotal memory usage (if available)Which clamd, local means unix socketThreadpool used to receive commandsExecuting commands, or scanningWaiting for commands, will exit after idle_timeoutMaximum number of threads configured for this poolTasks queued for processing, but not yet picked up by a threadCommand this thread is executingHow long this task is executingWhich file it is processing (if applicable)Used/free memory reported by libcMemory usage reported by libclamav's pool%2u %02u:%02u:%02u %3u %3u %5u %5u %5s %-7s %5s %-13s %s%2u %02u:%02u:%02u N/A N/A N/A N/A N/A %-7s %5s %-13s %sheap %4.0fM mmap %4.0fM unused%4.0fMused %4.0fM free %4.0fM total %4.0fMcount %4u used %4.0fM total %4.0fM*** %u more task(s) not shown ***Dump authenticode certificate chain.Perform HTML, script, and text normalizationAlways generate MDB entries for PE sectionsMaximum number of mismatched signatures when building a CVD. Zero disables this limit.Feature level to put in the CVDVersion number of the CVD to buildCreate a hybrid (standard and bytecode) database fileForce using the interpreter instead of the JITTrust loaded bytecode (default yes)Load and print bytecode information without executingPrint IR of bytecode signatureInput file to run the bytecode nDon't show source line during tracingNumber of entries the cache can store.Name of the analyzer as seen in prewikkaSave all reports to a log file.By default the log file is locked for writing and only a single daemon process can write to it. This option disables the lock.Maximum size of the log file. Value of 0 disables the limit.Log all clean files. Useful in debugging but drastically increases the log size.Use the system logger (can work together with LogFile).Type of syslog messages. Please refer to 'man syslog' for the facility names.Rotate log file. Requires LogFileMaxSize option set prior to this option.Log additional information about the infected file, such as its size and hash, together with the virus name.Save the process ID to a file.This option allows you to change the default temporary directory.This option allows you to change the default database directory. If you enable it, please make sure it points to the same directory in both clamd and freshclam.Only load the official signatures published by the ClamAV project.Return with a nonzero error code if the virus database is older than the specified number of days.By default, yara rules will be loaded. This option allows you to exclude yara rules when scanning and also to scan only using yara rules. Valid options are yes|no|onlyPath to a local socket file the daemon will listen on.Sets the group ownership on the unix socket.Sets the permissions on the unix socket to the specified mode.Remove a stale socket after unclean shutdownA TCP port number the daemon will listen on.By default clamd binds to INADDR_ANY. This option allows you to restrict the TCP address and provide some degree of protection from the outside world.Maximum length the queue of pending connections may grow to.Close the STREAM session when the data size limit is exceeded. The value should match your MTA's limit for the maximum attachment size.The STREAM command uses an FTP-like protocol. This option sets the lower boundary for the port range.This option sets the upper boundary for the port range.Maximum number of threads running at the same time.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any data.This option specifies the time (in seconds) after which clamd should timeout if a client doesn't provide any initial command after connecting.This option specifies how long to wait (in milliseconds) if the send buffer is full. Keep this value low to prevent clamd hanging.Waiting for data from clamd will timeout after this time (seconds).Maximum number of queued items (including those being processed by MaxThreads threads). It is recommended to have this value at least twice MaxThreads if possible. WARNING: you shouldn't increase this too much to avoid running out of file descriptors, the following condition should hold: MaxThreads*MaxRecursion + MaxQueue - MaxThreads + 6 < RLIMIT_NOFILE (usual max for RLIMIT_NOFILE is 1024) This option specifies how long (in seconds) the process should wait for a new job.Don't scan files/directories whose names match the provided regular expression. This option can be specified multiple times.Maximum depth the directories are scanned at.Follow symlinks to regular files.Scan files and directories on other filesystems.This option specifies the time intervals (in seconds) in which clamd should perform a database check.Enable non-blocking (multi-threaded/concurrent) database reloads. This feature will temporarily load a second scanning engine while scanning continues using the first engine. Once loaded, the new engine takes over. The old engine is removed as soon as all scans using the old engine have completed. This feature requires more RAM, so this option is provided in case users are willing to block scans during reload in exchange for lower RAM requirements.This option allows you to disable clamd's caching feature.Execute a command when virus is found. Use the following environment variables to identify the file and virus names: - $CLAM_VIRUSEVENT_FILENAME - $CLAM_VIRUSEVENT_VIRUSNAME In the command string, '%v' will also be replaced with the virus name. Note: The '%f' filename format character has been disabled and will no longer be replaced with the file name, due to command injection security concerns. Use the 'CLAM_VIRUSEVENT_FILENAME' environment variable instead. For the same reason, you should NOT use the environment variables in the command directly, but should use it carefully from your executed script.Stop the daemon when libclamav reports an out of memory condition.Permit use of the ALLMATCHSCAN command.Enable debug messages in libclamav.Don't remove temporary files (for debugging purposes).Record metadata about the file being scanned. Scan metadata is useful for file analysis purposes and for debugging scan behavior. The JSON metadata will be printed after the scan is complete if Debug is enabled. A metadata.json file will be written to the scan temp directory if LeaveTemporaryFiles is enabled.Run the daemon as a specified user (the process must be started by root).With this option enabled ClamAV will load bytecode from the database. It is highly recommended you keep this option on, otherwise you'll miss detections for many new viruses.Set bytecode security level. Possible values: TrustSigned - trust bytecode loaded from signed .c[lv]d files, insert runtime safety checks for bytecode loaded from other sources Paranoid - don't trust any bytecode, insert runtime checks for all Recommended: TrustSigned, because bytecode in .cvd files already has these checks.Set bytecode timeout in milliseconds.Allow loading bytecode from outside digitally signed .c[lv]d files.^(Auto|ForceJIT|ForceInterpreter|Test)$Set bytecode execution mode. Possible values: Auto - automatically choose JIT if possible, fallback to interpreter ForceJIT - always choose JIT, fail if not possible ForceInterpreter - always choose interpreter Test - run with both JIT and interpreter and compare results. Make all failures fatal.^(none|None|bytecode|Bytecode|pcre|PCRE)$Collect and print execution statistics. Possible values: Bytecode - reports bytecode statistics PCRE - reports PCRE execution statistics None - reports no statisticsDetect Potentially Unwanted Applications.Exclude a specific PUA category. This directive can be used multiple times. See https://docs.clamav.net/faq/faq-pua.html for the complete list of PUA categories.Only include a specific PUA category. This directive can be used multiple times.PE stands for Portable Executable - it's an executable file format used in all 32- and 64-bit versions of Windows operating systems. This option allows ClamAV to perform a deeper analysis of executable files and it's also required for decompression of popular executable packers such as UPX or FSG. If you turn off this option, the original files will still be scanned, but without additional processing.Executable and Linking Format is a standard format for UN*X executables. This option allows you to control the scanning of ELF files. If you turn off this option, the original files will still be scanned, but without additional processing.Enable the built in email scanner. If you turn off this option, the original files will still be scanned, but without parsing individual messages/attachments.Scan RFC1341 messages split over many emails. You will need to periodically clean up $TemporaryDirectory/clamav-partial directory. WARNING: This option may open your system to a DoS attack. Please don't use this feature on highly loaded servers.With this option enabled ClamAV will try to detect phishing attempts by using signatures.Scan URLs found in mails for phishing attempts using heuristics.In some cases (eg. complex malware, exploits in graphic files, and others), ClamAV uses special algorithms to provide accurate detection. This option controls the algorithmic detection.Allow heuristic match to take precedence. When enabled, if a heuristic scan (such as phishingScan) detects a possible virus/phish it will stop scan immediately. Recommended, saves CPU scan-time. When disabled, virus/phish detected by heuristic scans will be reported only at the end of a scan. If an archive contains both a heuristically detected virus/phish, and a real malware, the real malware will be reported. Keep this disabled if you intend to handle "Heuristics.*" viruses differently from "real" malware. If a non-heuristically-detected virus (signature-based) is found first, the scan is interrupted immediately, regardless of this config option.Enable the Data Loss Prevention module.This option sets the lowest number of Credit Card numbers found in a file to generate a detect.This option sets the lowest number of Social Security Numbers found in a file to generate a detect.With this option enabled the DLP module will search for valid SSNs formatted as xxx-yy-zzzz.With this option enabled the DLP module will search for valid SSNs formatted as xxxyyzzzzPerform HTML/JavaScript/ScriptEncoder normalisation and decryption. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning of OLE2 files, such as Microsoft Office documents and .msi files. If you turn off this option, the original files will still be scanned, but without additional processing.With this option enabled clamav will try to detect broken executables (PE, ELF, & Mach-O) and alert on them with a Broken.Executable heuristic signature.With this option enabled clamav will try to detect broken media files (JPEG, TIFF, PNG, GIF) and alert on them with a Broken.Media heuristic signature.Alert on encrypted archives and documents (encrypted .zip, .7zip, .rar, .pdf).With this option enabled the DLP module will search for valid Credit Card numbers only. Debit and Private Label cards will not be searched.Alert on encrypted archives (encrypted .zip, .7zip, .rar).Alert on encrypted documents (encrypted .pdf).With this option enabled OLE2 files with VBA macros, which were not detected by signatures will be marked as "Heuristics.OLE2.ContainsMacros".Alert on SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Alert on cloaked URLs, even if they're not in the database. This feature can lead to false positives.Alert on raw DMG image files containing partition intersections.This option enables scanning within PDF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning within SWF files. If you turn off this option, the original files will still be scanned, but without decoding and additional processing.This option enables scanning xml-based document files supported by libclamav. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning HWP3 files. If you turn off this option, the original files will still be scanned, but without additional processing.This option enables scanning OneNote files. If you turn off this option, the original files will still be scanned, but without additional processing.Scan within archives and compressed files. If you turn off this option, the original files will still be scanned, but without unpacking and additional processing.This option enables scanning of image (graphics). If you turn off this option, the original files will still be scanned, but without additional processing.This option enables detection by calculating a fuzzy hash of image (graphics) files Signatures using image fuzzy hashes typically match files and documents by identifying images embedded or attached to those files. If you turn off this option, then some files may no longer be detected.This option causes memory or nested map scans to dump the content to disk. If you turn on this option, more data is written to disk and is available when the leave-temps option is enabled at the cost of more disk writes.This option sets the maximum amount of time a scan may take to complete. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result allow scanning of certain files to lock up the scanning process/threads resulting in a Denial of Service. The value is in milliseconds.This option sets the maximum amount of data to be scanned for each input file. Archives and other containers are recursively extracted and scanned up to this value. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage.Files/messages larger than this limit won't be scanned. Affects the input file itself as well as files contained inside it (when the input file is an archive, a document or some other kind of container). The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Nested archives are scanned recursively, e.g. if a Zip archive contains a RAR file, all files within it will also be scanned. This option specifies how deeply the process should be continued. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.Number of files to be scanned within an archive, a document, or any other container file. The value of 0 disables the limit. WARNING: disabling this limit or setting it too high may result in severe damage to the system.This option sets the maximum size of a file to check for embedded PE. Files larger than this value will skip the additional analysis step. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a HTML file to normalize. HTML files larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a normalized HTML file to scan. HTML files larger than this value after normalization will not be scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a script file to normalize. Script content larger than this value will not be normalized or scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum size of a ZIP file to reanalyze type recognition. ZIP files larger than this value will skip the step to potentially reanalyze as PE. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of partitions of a raw disk image to be scanned. Raw disk images with more partitions than this value will have up to the value number partitions scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum number of icons within a PE to be scanned. PE files with more icons than this value will have up to the value number icons scanned. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum recursive calls to HWP3 parsing function. HWP3 files using more than this limit will be terminated and alert the user. Scans will be unable to scan any HWP3 attachments if the recursive limit is reached. Negative values are not allowed. WARNING: setting this limit too high may result in severe damage or impact performance.This option sets the maximum calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit, see the PCRE documentation. Negative values are not allowed. WARNING: setting this limit too high may severely impact performance.This option sets the maximum recursive calls to the PCRE match function during an instance of regex matching. Instances using more than this limit will be terminated and alert the user but the scan will continue. For more information on match_limit_recursion, see the PCRE documentation. Negative values are not allowed and values > PCREMatchLimit are superfluous. WARNING: setting this limit too high may severely impact performance.This option sets the maximum filesize for which PCRE subsigs will be executed. Files exceeding this limit will not have PCRE subsigs executed unless a subsig is encompassed to a smaller buffer. Negative values are not allowed. Setting this value to zero disables the limit. WARNING: setting this limit too high or disabling it may severely impact performance.This option specifies a directory or mount point which should be scanned on access. The mount point specified, or the mount point containing the specified directory will be watched, but only notifications will occur. If any directories are specified, this option will preempt the DDD system. It can also be used multiple times.This option specifies a directory (including all files and directories inside it), which should be scanned on access. This option can be used multiple times.This option allows excluding directories from on-access scanning. It can be used multiple times. Only works with DDD system.Use this option to exclude the root UID (0) and allow any processes run under root to access all watched files without triggering scans.With this option you can exclude specific UIDs. Processes with these UIDs will be able to access all files. This option can be used multiple times (one per line). Using a value of 0 on any line will disable this option entirely. To exclude the root UID please enable the OnAccessExcludeRootUID option.This option allows exclusions via user names when using the on-access scanning client. It can be used multiple times.Files larger than this value will not be scanned in on access.This option toggles the dynamic directory determination system for on-access scanning (Linux only).This option changes fanotify behavior to prevent access attempts on malicious files instead of simply notifying the user (On Access scan only).Enables extra scanning and notification after catching certain inotify events. Only works with the DDD system enabled.Max amount of time (in milliseconds) that the OnAccess client should spend for every connect, send, and receive attempt when communicating with clamd via curl (5s default)Max number of scanning threads to allocate to the OnAccess thread pool at startup--these threads are the ones responsible for creating a connection with the daemon and kicking off scanning after an event has been processed. To prevent clamonacc from consuming all clamd's resources keep this lower than clamd's max threads. Default is 5Number of times the OnAccess client will retry a failed scan due to connection problems (or other issues). Defaults to no retries.When using prevention, if this option is turned on, any errors that occur during scanning will result in the event attempt being denied. This could potentially lead to unwanted system behaviour with certain configurations, so the client defaults to off and allowing access events in case of error.When started by root freshclam will drop privileges and switch to the user defined in this option.This option defined how many times daily freshclam should check for a database update.Use DNS to verify the virus database version. FreshClam uses DNS TXT records to verify the versions of the database and software itself. With this directive you can change the database verification domain. WARNING: Please don't change it unless you're configuring freshclam to use your own database verification domain.DatabaseMirror specifies to which mirror(s) freshclam should connect. You should have at least one entry: database.clamav.net.This option allows you to easily point freshclam to private mirrors. If PrivateMirror is set, freshclam does not attempt to use DNS to determine whether its databases are out-of-date, instead it will use the If-Modified-Since request or directly check the headers of the remote database files. For each database, freshclam first attempts to download the CLD file. If that fails, it tries to download the CVD file. This option overrides DatabaseMirror, DNSDatabaseInfo and Scripted Updates. It can be used multiple times to provide fall-back mirrors.mirror1.mynetwork.com mirror2.mynetwork.comThis option defines how many attempts freshclam should make before giving up.With this option you can control scripted updates. It's highly recommended to keep them enabled.With this option enabled, freshclam will attempt to load new databases into memory to make sure they are properly handled by libclamav before replacing the old ones. Tip: This feature uses a lot of RAM. If your system has limited RAM and you are actively running ClamD or ClamScan during the update, then you may need to set `TestDatabases no`.By default freshclam will keep the local databases (.cld) uncompressed to make their handling faster. With this option you can enable the compression. The change will take effect with the next database update.Include an optional signature databases (opt-in). This option can be used multiple times.Exclude a standard signature database (opt-out). This option can be used multiple times.With this option you can provide custom sources (http:// or file://) for database files. This option can be used multiple times.http://myserver.com/mysigs.ndb file:///mnt/nfs/local.hdbIf you're behind a proxy, please enter its address here.A user name for the HTTP proxy authentication.A password for the HTTP proxy authentication.If your servers are behind a firewall/proxy which does a User-Agent filtering you can use this option to force the use of a different User-Agent header.Send the RELOAD command to clamd after a successful update.Run a command after a successful database update. Use EXIT_1 to return 1 after successful database update.Run a command when a database update error occurs.Run a command when freshclam reports an outdated version. In the command string %v will be replaced with the new version number.With this option you can provide a client address for the database downloading. Useful for multi-homed systems.Timeout in seconds when connecting to database server.Timeout in seconds when reading from database server. 0 means no timeout.This option enables downloading of bytecode.cvd, which includes additional detection mechanisms and improvements to the ClamAV engine.Disable authenticode certificate chain verification in PE files.Deprecated option to download signatures derived from the Google Safe Browsing API. See https://blog.clamav.net/2020/06/the-future-of-clamav-safebrowsing.html for more details.Deprecated option to set the max-scantime. The value is in milliseconds.Deprecated option to alert on broken PE and ELF executable files.Deprecated option to enable heuristic alerts (e.g. "Heuristics.")PhishingAlwaysBlockSSLMismatchDeprecated option to alert on SSL mismatches in URLs, even if they're not in the database. This feature can lead to false positives.Deprecated option to alert on cloaked URLs, even if they're not in the database. This feature can lead to false positives.Deprecated option to alert on raw DMG image files containing partition intersections.Deprecated option to alert on encrypted archives and documents (encrypted .zip, .7zip, .rar, .pdf).Initialize a supplementary group access (the process must be started by root).Define the clamd socket to connect to for scanning. This option is mandatory! Syntax: ClamdSocket unix:path ClamdSocket tcp:host:port The first syntax specifies a local unix socket (needs an absolute path) e.g.: ClamdSocket unix:/run/clamav/clamd.sock The second syntax specifies a tcp local or remote tcp socket: the host can be a hostname or an ip address; the ":port" field is only required for IPv6 addresses, otherwise it defaults to 3310 ClamdSocket tcp:192.168.0.1 This option can be repeated several times with different sockets or even with the same socket: clamd servers will be selected in a round-robin fashion.Define the interface through which we communicate with sendmail. This option is mandatory! Possible formats are: [[unix|local]:]/path/to/file - to specify a unix domain socket; inet:port@[hostname|ip-address] - to specify an ipv4 socket; inet6:port@[hostname|ip-address] - to specify an ipv6 socket./tmp/clamav-milter.sock inet:7357Define the group ownership for the (unix) milter socket.Sets the permissions on the (unix) milter socket to the specified mode.Messages originating from these hosts/networks will not be scanned This option takes a host(name)/mask pair in CIRD notation and can be repeated several times. If "/mask" is omitted, a host is assumed. To specify a locally originated, non-smtp, email use the keyword "local".local 192.168.0.0/24 1111:2222:3333::/48^(Accept|Reject|Defer|Blackhole|Quarantine)$Action to be performed on clean messages (mostly useful for testing). The following actions are available: Accept: the message is accepted for delivery Reject: immediately refuse delivery (a 5xx error is returned to the peer) Defer: return a temporary failure message (4xx) to the peer Blackhole: like Accept but the message is sent to oblivion Quarantine: like Accept but message is quarantined instead of being deliveredAction to be performed on error conditions (this includes failure to allocate data structures, no scanners available, network timeouts, unknown scanner replies and the like. The following actions are available: Accept: the message is accepted for delivery; Reject: immediately refuse delivery (a 5xx error is returned to the peer); Defer: return a temporary failure message (4xx) to the peer.This option allows you to set a specific rejection reason for infected messages and it's therefore only useful together with "OnInfected Reject" The string "%v", if present, will be replaced with the virus name.If this option is set to "Replace" (or "Yes"), an "X-Virus-Scanned" and an "X-Virus-Status" headers will be attached to each processed message, possibly replacing existing headers. If it is set to Add, the X-Virus headers are added possibly on top of the existing ones. Note that while "Replace" can potentially break DKIM signatures, "Add" may confuse procmail and similar filters.When AddHeader is in use, this option allows you to set the reported hostname. This may be desirable in order to avoid leaking internal names. If unset the real machine name is used.Execute a command when an infected message is processed. The following parameters are passed to the invoked program in this order: virus name, queue id, sender, destination, subject, message id, message date. Note #1: this requires MTA macroes to be available (see LogInfected below) Note #2: the process is invoked in the context of clamav-milter Note #3: clamav-milter will wait for the process to exit. Be quick or fork to avoid unnecessary delays in email delivery/usr/local/bin/my_infected_message_handlerChroot to the specified directory. Chrooting is performed just after reading the config file and before dropping privileges.This option specifies a file which contains a list of basic POSIX regular expressions. Addresses (sent to or from - see below) matching these regexes will not be scanned. Optionally each line can start with the string "From:" or "To:" (note: no whitespace after the colon) indicating if it is, respectively, the sender or recipient that is to be allowed. If the field is missing, "To:" is assumed. Lines starting with #, : or ! are ignored.Messages from authenticated SMTP users matching this extended POSIX regular expression (egrep-like) will not be scanned. As an alternative, a file containing a plain (not regex) list of names (one per line) can be specified using the prefix "file:". e.g. SkipAuthenticated file:/etc/good_guys Note: this is the AUTH login name!SkipAuthenticated ^(tom|dick|henry)$This option allows you to tune what is logged when a message is infected. Possible values are Off (the default - nothing is logged), Basic (minimal info logged), Full (verbose info logged) Note: For this to work properly in sendmail, make sure the msg_id, mail_addr, rcpt_addr and i macroes are available in eom. In other words add a line like: Milter.macros.eom={msg_id}, {mail_addr}, {rcpt_addr}, i to your .cf file. Alternatively use the macro: define(`confMILTER_MACROS_EOM', `{msg_id}, {mail_addr}, {rcpt_addr}, i') Postfix should be working fine with the default settings.This option allows you to tune what is logged when no threat is found in a scanned message. See LogInfected for possible values and caveats. Useful in debugging but drastically increases the log size.This option affects the behaviour of LogInfected, LogClean and VirusAction when a message with multiple recipients is scanned: If SupportMultipleRecipients is off (the default) then one single log entry is generated for the message and, in case the message is determined to be malicious, the command indicated by VirusAction is executed just once. In both cases only the last recipient is reported. If SupportMultipleRecipients is on: then one line is logged for each recipient and the command indicated by VirusAction is also executed once for each recipient. Note: although it's probably a good idea to enable this option, the default value is currently set to off for legacy reasons.idx == 0Out of memoryUser interruptFailed to get terminal size H - helpQ - quitR - reset maximums^ - previous clamdv - next clamd][%s%s%s:%s3310socketConnecting to: %s connectLooking up: %s:%s conn && conn->sd > 0nEND Abnormal program termination in %s at line %u%-15s %sPOSIXLY_CORRECT%s: illegal option -- %c %s: unrecognized option `%s' %s: option `%s' is ambiguous Example ERROR: Unknown option passed yestrueconnlen > 0len <= (size_t)nreadlocal????%a %b %d %H:%M:%S %Y%lfMEMSTATSUNKNOWN COMMANDStatePRIMARY live %u idle %u max %uUNKNOWN COMMAND nIDSESSION nVERSION nSESSION nVERSION Unable to reconnect to %s: %slocalhost1.4.6defaultcolorsconfig-fileLocalSocketTCPSocketTCPAddr%lld%.0f%c%.1f%c%.2f%cFailed to initialize curses Unique clamd numberNOHow long it is connectedCONNTIMETotal number of live threadsLIVTotal number of idle threadsIDLNumber of items in queueQUEUEMAXQMEMEngine versionENGINEDatabase versionDBVERDatabase publish timeDBTIMEHOSTPrimary threadsliveidleQUEUEDSINCEFILEMemory usage reported by libcMemLibcPoolPress any key to exit help ClamdTOP version %s nSTATS %04u-%02u-%02uT%02uDetails for Clamd version: %sPrimary threads: live%3u idle%3u max%3uQueue:%6u items %6u maxMem: Libc: Pool: tasks%2u %s%10.03fs...^(yes|true|1|no|false|0)$/etc/clamd.d/scan.conf/etc/freshclam.conf/etc/mail/clamav-milter.confdebuggen-jsondumpcertsquietleave-tempsno-warningsshow-progressstdoutdaemonno-dnslist-mirrorsupdate-dbreloadmultiscanfdpassstreamallmatchdatabase/var/lib/clamavrecursivegen-mdbfollow-dir-symlinks^[0-9]+$follow-file-symlinksbellno-summaryfile-listinfectedpingwaitsuppress-ok-resultscopyremoveexcludeexclude-dirincludeinclude-dirstructured-ssn-formathex-dumpmd5sha1sha256impfuzzy-imgprint-certshtml-normaliseascii-normaliseutf16-decodebuildmax-bad-sigs3000flevelcvd-versionno-cdiffserverunpackunpack-currentinfolist-sigsfind-sigsdecode-sigstest-sigsvbavba-hexcomparerun-cdiffverify-cdiffhybridconfig-dir/etcnon-defaultgenerate-configforce-interpretertrust-bytecodeprintsrcPrint source code of bytecodeprintbcirinputtracebytecode trace levelno-trace-showsourcearchive-verbosebytecode-trust-allhttp-proxyproxy-userlog-verboseforcedisable-summarydisable-archiveno-archiveno-peno-elfno-ole2no-pdfno-htmlno-mailno-phishing-sigsno-phishing-scan-urlsno-algorithmicno-phishing-restrictedscanmax-ratiomax-space^[0-9]+[KMG]?$unzipfoounrararjunzoolhajartartgzdebAlertExceedsMaxalert-exceeds-maxCacheSizecache-size65536PreludeEnableprelude-enableEnable preludePreludeAnalyzerNameprelude-analyzer-name/tmp/clamav.logLogFileUnlockLogFileMaxSize5MLogTimeLog time with each message.LogCleanLogSyslogLogFacilityLOG_LOCAL6LOG_MAILLogVerboseEnable verbose logging.LogRotatelog-rotateExtendedDetectionInfoPidFile/run/clamav/clam.pidTemporaryDirectorytempdir/tmpDatabaseDirectorydatadirOfficialDatabaseOnlyofficial-db-onlynoFailIfCvdOlderThanfail-if-cvd-older-than-1YaraRulesyara-rules/run/clamav/clamd.sockLocalSocketGroupvirusgroupLocalSocketMode660FixStaleSocketMaxConnectionQueueLength30StreamMaxLength100MStreamMinPort1024StreamMaxPort2048120CommandReadTimeoutSendBufTimeout200300MaxQueueIdleTimeout^/proc/ ^/sys/MaxDirectoryRecursionmax-dir-recursion15FollowDirectorySymlinksFollow directory symlinks.FollowFileSymlinksCrossFilesystemscross-fsSelfCheck600ConcurrentDatabaseReloadDisableCachedisable-cacheVirusEvent/opt/send_virus_alert_sms.shExitOnOOMAllowAllMatchScanForegroundforegroundDon't fork into background.DebugLeaveTemporaryFilesGenerateMetadataJsonUserBytecodeBytecodeSecurity^(TrustSigned|Paranoid)$TrustSignedBytecodeTimeoutbytecode-timeout10000BytecodeUnsignedbytecode-unsignedBytecodeModebytecode-modeAutoStatisticsstatisticsNoneDetectPUAdetect-puaExcludePUAexclude-puaNetTool PWToolIncludePUAinclude-puaSpy Scanner RATScanPEscan-peScanELFscan-elfScanMailscan-mailScanPartialMessagesPhishingSignaturesPhishingScanURLsHeuristicAlertsheuristic-alertsHeuristicScanPrecedenceheuristic-scan-precedenceStructuredDataDetectiondetect-structuredStructuredMinCreditCardCountstructured-cc-countStructuredMinSSNCountstructured-ssn-countStructuredSSNFormatNormalStructuredSSNFormatStrippedScanHTMLscan-htmlScanOLE2scan-ole2AlertBrokenExecutablesalert-brokenAlertBrokenMediaalert-broken-mediaAlertEncryptedalert-encryptedStructuredCCOnlystructured-cc-modeAlertEncryptedArchivealert-encrypted-archiveAlertEncryptedDocalert-encrypted-docAlertOLE2Macrosalert-macrosAlertPhishingSSLMismatchalert-phishing-sslAlertPhishingCloakalert-phishing-cloakAlertPartitionIntersectionalert-partition-intersectionScanPDFscan-pdfScanSWFscan-swfScanXMLDOCSscan-xmldocsScanHWP3scan-hwp3ScanOneNotescan-onenoteScanArchivescan-archiveScanImagescan-imageScanImageFuzzyHashscan-image-fuzzy-hashForceToDiskforce-to-diskMaxScanTimemax-scantime120000max-scansize400Mmax-recursion17max-filesMaxEmbeddedPEmax-embeddedpe40MMaxHTMLNormalizemax-htmlnormalizeMaxHTMLNoTagsmax-htmlnotags8MMaxScriptNormalizemax-scriptnormalize20MMaxZipTypeRcgmax-ziptypercg1MMaxPartitionsmax-partitions128MaxIconsPEmax-iconspe100MaxRecHWP3max-rechwp316PCREMatchLimitpcre-match-limit100000PCRERecMatchLimitpcre-recmatch-limit5000PCREMaxFileSizepcre-max-filesizeOnAccessMountPath/ /home/userOnAccessIncludePath/home /studentsOnAccessExcludePath/home/bofh /rootOnAccessExcludeRootUIDOnAccessExcludeUIDOnAccessExcludeUnameclamuserOnAccessMaxFileSizeOnAccessDisableDDDOnAccessPreventionOnAccessExtraScanningOnAccessCurlTimeout10000LOnAccessMaxThreadsOnAccessRetryAttemptsOnAccessDenyOnErrorwatch-listexclude-listDevACOnlydev-ac-onlyDevACDepthdev-ac-depthDevPerformancedev-performanceDevLiblogdev-liblogUpdateLogFile/var/log/freshclam.logDatabaseOwnerclamupdateCheckschecksDNSDatabaseInfocurrent.cvd.clamav.netDatabaseMirrordatabase.clamav.netPrivateMirrorMaxAttemptsScriptedUpdatesTestDatabasesCompressLocalDatabaseExtraDatabasedbname1 dbname2ExcludeDatabaseDatabaseCustomURLHTTPProxyServeryour-proxyHTTPProxyPortHTTP proxy's port8080HTTPProxyUsernameusernameHTTPProxyPasswordHTTPUserAgentNotifyClamddaemon-notifyOnUpdateExecuteon-update-executecommandOnErrorExecuteon-error-executeOnOutdatedExecuteon-outdated-executeLocalIPAddresslocal-addressaaa.bbb.ccc.dddConnectTimeoutReceiveTimeoutDisableCertChecknocertsSafeBrowsingTimeLimittimelimitDetectBrokenExecutablesdetect-brokenAlgorithmicDetectionalgorithmic-detectionblock-maxPhishingAlwaysBlockCloakOLE2BlockMacrosblock-macrosArchiveBlockEncryptedblock-encryptedMailMaxRecursionArchiveMaxScanSizeArchiveMaxRecursionArchiveMaxFilesArchiveMaxCompressionRatioArchiveBlockMaxArchiveLimitMemoryUsageMailFollowURLsmail-follow-urlsAllowSupplementaryGroupsScanOnAccessClamdSockettcp:scanner.mydomain:7357MilterSocketMilterSocketGroupMilterSocketModeLocalNetOnCleanAcceptOnInfectedQuarantineOnFail^(Accept|Reject|Defer)$DeferRejectMsgMTA specificAddHeader^(No|Replace|Yes|Add)$ReplaceReportHostnamemy.mail.server.nameVirusActionChroot/newrootAllowList/etc/allowed_addressesWhitelistSkipAuthenticatedLogInfectedBasicSupportMultipleRecipientsù3ÿÿ“3ÿÿÅ2ÿÿE4ÿÿÅ2ÿÿrecv_linedetail_is_selectedoutput_statsoutput_queuesetup_connectionssigintread_versionparse_queueparse_statsreconnectsend_string_noreconnmake_connection_realprint_con_infoshow_barresize€„.Að¿�@P?ÍÌÌÌÌüX@= ×£pý#@@�@àCheap N/A mmap N/A unused N/used N/A free N/A total N/;,$Påþÿ`ëþÿˆÀðþÿ Ððþÿì@ÿÿH0ÿÿ `ÿÿ´ ÿÿÜ ÿÿ   ÿÿ$� ÿÿdÀ ÿÿÈð ÿÿäPÿÿ€ÿÿ€ÿÿœ0ÿÿ¸ÿÿøÀÿÿ<°ÿÿ˜°ÿÿèÿÿÿÿd`ÿÿ�Àÿÿ¸€ÿÿÿÿ0�#ÿÿ|À)ÿÿ̰8ÿÿ@�:ÿÿ¤ÀBÿÿÀCÿÿ<°DÿÿxpEÿÿ¤�Jÿÿè zRx �ðÿÿ&D$4èãþÿÀFJ w€?:*3$"\€éþÿ°tˆÿÿ%$ˆ¤ÿÿ¶A†AƒD ­AA,°<ÿÿÔKŒD†A ƒ¿ABAÃÆÌàìÿÿ•D�<øtÿÿëK�BŒD †A(ƒG0Ê(A ABBAÃÆÌÍ`8$ ÿÿ,B�BŽB �E(ŒA0†D8ƒGPk 8G0A(B BBBN t 8A0A(B BBBB œð ÿÿ%AA^¸ ÿÿXAAK|ÔH ÿÿ-B�BŽB �B(ŒA0†A8ƒD@( 8A0A(B BBBH Y 8L0A(B BBBJ K 8K0H(B BBBE Tø ÿÿ‡Aƒ…plÿÿ EAU<ŒpÿÿÌB�EŒA †A(ƒJ€y (A ABBF @Ìÿÿ²BŒAƒD x DBK T DBF n DBA X|ÿÿéB�BŒA †A(ƒD0h8M@OHCPI0G (A ABBI l(D DBBLlÿÿöB�BŽB �B(ŒA0†D8ƒJ y 8D0A(B BBBC (¼ÀÿÿVBŒA†D l ABA LèôÿÿìF�BŒA †A(ƒD0' (A ABBE ~ (F ABBG (8”ÿÿ[F†DƒG DAAAÃÆ$dÈÿÿXBŒDƒD GDBLŒÿÿ¼B�EŒD †D(ƒD0g (A ABBH � (C ABBA $Üpÿÿ{BŒKƒG SDKHÈÿÿ‚B�EŽB �B(ŒA0†D8ƒM`ª 8D0A(B BBBD LP ÿÿ$B�BŽH �E(ŒA0†D8ƒM d 8D0A(B BBBD P ì"ÿÿíB�BŽB �B(ŒA0†A8ƒG¸ L 0² 8A0A(B BBBA ô˜éþÿ  0ƒ†Œ�Ž�`h1ÿÿÖBŽB�B ŒA(†A0ƒÏ (A BBBB E (A BBBD A (C BBBA `xä2ÿÿ*B�BŽB �B(ŒD0†D8ƒG� ) 8A0A(B BBBF ]˜ x  G¨ A° K� 0ܰ:ÿÿøBŒA†D ƒG°¯  AABG 8|;ÿÿëBŒA†A ƒa ABH T ADC (L0<ÿÿ·BŒA†D \ ABA DxÄ<ÿÿBŽL�D ŒA(†A0ƒGÀû 0M(A BBBE øÀÜçþÿpF�BŽB �B(ŒD0†J8ƒGà=èJðQøK€BˆA�E˜E E¨F°F¸FÀKàièYðEøM€NàoèCðJøQ€KˆF�F˜F KàDèLðIèEà_èYðMèEàlèNðIøB€Màq 8C0A(B BBBG ¼ @ÿÿð°ÂÀÛœh ¡ÿ`�`�ƒžc&¡‘`�`�ƒž=¡`�`�ƒžcQ¡`�`�ŽŸV ¡ÿ`�`�n¡ ¡+`�`�t¡ ¡)`�`�»¤v ¡:`�`�}¡ ¡P"`�‡¡ ¡:`�`��¡ ¡(`�`�™¡ ¡`�`�¥¡ ¡`�`�³¡ ¡:`�`�º¡d ¡`�`�Á¡ ¡`�`�È¡ ¡`�`�Õ¡ÿÿÿÿÿÿÿÿ`�`�ß¡ ¡`�`�æ¡m ¡`�`�ð¡ ¡`�`�÷¡ ¡`�`�þ¡z ¡`�`�D° ¡x"`�¢dÿÿÿÿÿÿÿÿ¢`�`� ¢r ¡`�`�*¢ ¡¨"`�2¢F¢`�`�O¢F¢`�`�d¢ ¡`�`�i¢ ¡`�`�t¢fÿÿÿÿÿÿÿÿ`�`�~¢i ¡`�`�‡¢pÿÿÿÿÿÿÿÿ`�`�Œ¢w ¡`�`�‘¢o ¡`�`�¬¢ÿÿÿÿÿÿÿÿ`�`�¥¢ÿÿÿÿÿÿÿÿ`�`�ª¢ ¡`�`�±¢ÿÿÿÿÿÿÿÿ`�`�¹¢ÿÿÿÿÿÿÿÿ`�`�Å¢ÿÿÿÿÿÿÿÿ`�`�Í¢ÿÿÿÿÿÿÿÿ`�`�Ù¢F¢`�`�ï¢ ¡ `�`�ø¢ ¡ `�`�ü¢ ¡ `�`�£ ¡ `�`�.¢ ¡ `�`�£ ¡ `�`� £ ¡ `�`�£ÿÿÿÿÿÿÿÿ `�`�"£ÿÿÿÿÿÿÿÿ `�`�1£ÿÿÿÿÿÿÿÿ `�`�A£ÿÿÿÿÿÿÿÿ `�`�N£bÿÿÿÿÿÿÿÿ `�`�T£F¢¸ Ø"a£f£F¢Ø 0#`�m£F¢ P#`�« ¡ `�`�y£ ¡ `�`�‚£ÿÿÿÿÿÿÿÿ `�`�‰£uÿÿÿÿÿÿÿÿ `�`��£ÿÿÿÿÿÿÿÿ `�`�Ÿ£iÿÿÿÿÿÿÿÿ `�`�¤£lÿÿÿÿÿÿÿÿ¢ `�`�®£fÿÿÿÿÿÿÿÿ¢ `�`�¸£ ¡ `�`�Ä£ÿÿÿÿÿÿÿÿ `�`�Σÿÿÿÿÿÿÿÿ `�`�Ò£ÿÿÿÿÿÿÿÿ `�`�ç£dÿÿÿÿÿÿÿÿ `�`�Ú£cÿÿÿÿÿÿÿÿ `�`�â£rÿÿÿÿÿÿÿÿ `�`�ì£ÿÿÿÿÿÿÿÿ `�`�ù£ ¡ x#`�užd ¡€`�`�¤c ¤@`�`�¤n ¡@`�`�¤gÿÿÿÿÿÿÿÿ@`�`�,¤f ¡°#`�>¤t ¡à#`�Ÿ£i ¡$`�M¤p ¡V¤`�t¤c ¡@$`�~¤rÿÿÿÿÿÿÿÿ`$`�„¤TF¢Ф`�Ÿ¤s ¡ˆ$`�³¤a ¡`�`�ät ¡`�`�Ö¤`�`�á¤`�`�ì¤`�`�ø¤ ¡`�`�þ¤ ¡`�`�¥ ¡`�`�¥ ¡`�`�)¥ ¡`�`�/¥ ¡`�`�6¥ ¡`�`�>¥ ¡`�`�E¥ ¡`�`�M¥ ¡`�`�U¥ ¡`�`�f¥ ¡`�`�|¥ ¡`�`�‹¥ ¡`�`�¦¥F¢`�`�°¥º¥`�`�É¥ÿÿÿÿÿÿÿÿÏ¥`�`�Ó¥ÿÿÿÿÿÿÿÿÏ¥`�`�Ù¥ÿÿÿÿÿÿÿÿÏ¥`�`�Ý¥ÿÿÿÿÿÿÿÿÏ¥`�`�ã¥ÿÿÿÿÿÿÿÿÏ¥`�`�ç¥ÿÿÿÿÿÿÿÿÏ¥`�`�ë¥ÿÿÿÿÿÿÿÿÏ¥`�`�ï¥ÿÿÿÿÿÿÿÿÏ¥`�`�ó¥ÿÿÿÿÿÿÿÿÏ¥`�`�÷¥¦ ¡ `�`�¦#¦F¢ °$.¦4¦B¦ ¡Q¦`�`¦t¦ÿÿÿÿÿÿÿÿØ$`�[³v³lÿÿÿÿÿÿÿÿ%Цš¦ ¡(%�¨¦º¥¨%·¦º¦ ¡¦�Þ¦ ¡è%�ç¦ ¡@&�ñ¦ÿÿÿÿÿÿÿÿý¦x&§§ ¡§�4§>§ ¡È&�I§ ¡'�_§x§pÿÿÿÿÿÿÿÿˆ'g§|§�§ÿÿÿÿÿÿÿÿ-¨'—§œ§®§ÿÿÿÿÿÿÿÿ¢#ð'¢¶§˧ ¡ ˜(ܧß§ò§F¢ÿÿÿÿÿÿÿÿ à( ¨ ¨¨H)��žÿÿÿÿÿÿÿÿð)!¨8¨ÿÿÿÿÿÿÿÿ(*I¨T¨ÿÿÿÿÿÿÿÿX*d¨h¨ ¡˜*�›žF¢ÿÿÿÿÿÿÿÿÈ*`œ¥žÿÿÿÿÿÿÿÿø*ežw¨F¢È�+�¨“¨º¥@Ð+£¨¨¨F¢X,¶¨»¨F¢À,ɨ¦²F¢ ø,ϨÙ¨F¢x0-ΨÒ¨F¢¨-�¨å¨F¢ô8.ô¨Ù¨F¢xÀ.ø¨ü¨F¢d/ô¨©F¢˜0e¨αÿÿÿÿÿÿÿÿð0© ©6©F¢ p1H©K© ¡c©ܧ~© ¡ 1ܧ‘©¢© ¡ È1�«©F¢X2µ©¹© ¡h2�Ò©ß© ¡ 84ܧí©ÿÿÿÿÿÿÿÿx4ø©ª ¡à6�ª ¡(7�1ª<ªF ¡Gªܧcª ¡P7ܧiª ¡x7ܧ}ª ¡°7ܧ’ªÿÿÿÿÿÿÿÿè8¢—ªk¤ ¡ 89� ª±ªÿÿÿÿÿÿÿÿʪè9ʪÖªæªF¢' 8;÷ªýª« ¡ `;ܧ «-«¨;ÿÿÿÿÿÿÿÿ;« Ð;;«@«K«=ÿÿÿÿÿÿÿÿ0=V«[«e« ¡ Ø=�p«{«ÿÿÿÿÿÿÿÿ >‡«–«¡«ÿÿÿÿÿÿÿÿ °>­«½«Ä« ¡ ?�̫ԫ ¡  @�Ý«æ« ¡ �A�ð« ¡0Bܧ¬X¥ ¡ (C�¬i¥ ¡ ˆC�(¬8¬ ¡ ÐC�I¬a¬ ¡ �D�{¬“¬ ¡ (Gܧ¥¬¬F¢ PGI©Ö¬ì¬F¢ °GI©­ ¡H�­ ¡xHܧ7­@­ ¡ ØH�J­S­ ¡ ˆI�]­t­ ¡ XJ��­’­ ¡ øJ�¥­´­ ¡ �KܧÄ­Õ­ ¡ àKܧè­þ­ ¡ pLܧ®(® ¡ °Lܧ<®L® ¡ àLܧY®r® ¡ pM`�…®˜® ¡ àMܧ­®È® ¡ HN�å®í® ¡ �N�ö®þ® ¡ 8O�¯¯ ¡ àO� ¯)¯ ¡ ˜P�3¯?¯ ¡ 0Q�L¯X¯ ¡ ÈQ�e¯o¯ ¡ pR�z¯�¯ ¡ S�£¯¯¯ ¡ 0Tܧ½¯ɯF¢ UÖ¯Ò¶ݯº¥ HVê¯e±v±º¥@ hW£¨å¶ï¯F¢ ¸Xý¯ù¶°F¢' Z÷ª °°º¥€ àZ'°+°<°º¥€ è['°N°\°º¥€ è\k°n°�°º¥@ ø]•°™°§°º¥ _¶°¹°ǰF¢2 `Ö°Ú°å°F¢d Xañ°õ°±F¢ xb ±±±F¢ † àc/±6±H±F¢Ð Xe\±a±q±º¥@ g£¨ƒ±ÿÿÿÿÿÿÿÿxh•±¢±ÿÿÿÿÿÿÿÿÀi¶±Ʊÿÿÿÿÿÿÿÿ`j򱑱 ¡ÿÿÿÿÿÿÿÿàjܧ²F¢ÿÿÿÿÿÿÿÿpkÏ›²ÿÿÿÿÿÿÿÿ l*²3²º¥Pm·¦G² ¡XmܧZ² ¡Àm�m² ¡Pn�ƒ²F¢ˆÈn—²ž²F¢xobœ±²F¢Ðpþ°Dz ¡Xq�Û²Wÿÿÿÿÿÿÿÿ`�`�æ²eÿÿÿÿÿÿÿÿ`�`�ó²ý² ¡ÿÿÿÿÿÿÿÿ `�`� ³³F¢ÿÿÿÿÿÿÿÿ `�`�!³0³ ¡ÿÿÿÿÿÿÿÿ `�`�@³J³ ¡ÿÿÿÿÿÿÿÿ`�`�U³v³lÿÿÿÿÿÿÿÿ%c³z³ç¤uÿÿÿÿÿÿÿÿˆ³ˆrˆ³“³š³cF¢ ðr¸¨¡³ÿÿÿÿÿÿÿÿ±³Hs±³ȳÿÿÿÿÿÿÿÿˆt׳ë³ÿÿÿÿÿÿÿÿu0wù³F¢`wI©´ ¡°w�´ ¡x�#´ ¡xy`�9´ÿÿÿÿÿÿÿÿPzG´W´ÿÿÿÿÿÿÿÿ°zG´g´ÿÿÿÿÿÿÿÿ{˜{y´ÿÿÿÿÿÿÿÿØ{‰´”´F¢ÿÿÿÿÿÿÿÿ¢´´´¹´ÿÿÿÿÿÿÿÿ|Ë´Ô´ÿÿÿÿÿÿÿÿH|ò¡æ´ÿÿÿÿÿÿÿÿx|¤ô´µÿÿÿÿÿÿÿÿ&¡}�µµÿÿÿÿÿÿÿÿX}0µ8µGµÿÿÿÿÿÿÿÿÈ}0µXµjµÿÿÿÿÿÿÿÿ~0µ~µ�µaÿÿÿÿÿÿÿÿˆ~›µ«µF¢ø~�¨ºµF¢<0e¨—ª ¡€�ɵÚµ ¡ €ܧâµ ¡P€ܧïµùµF¢�Ö¯¶¶ ¡ X�ܧ)¶>¶ ¡  �ܧ$·T¶ ¡ `�`�ð�x® ¡ ‚ܧ^¶ž® ¡ ˜‚ܧ²®ή ¡ ƒܧw¶‡¶ ¡ àLܧ”¶ª¶ ¡ pƒܧº¶ÿÿÿÿÿÿÿÿ`�`�˶ÿÿÿÿÿÿÿÿ`�`�Þ¶ÿÿÿÿÿÿÿÿ`�`�ò¶ÿÿÿÿÿÿÿÿ`�`�·ÿÿÿÿÿÿÿÿ`�`�· ¡ÿÿÿÿÿÿÿÿ`�`�-· ¡ÿÿÿÿÿÿÿÿ`�`�E·T· ¡ÿÿÿÿÿÿÿÿ `�`�e· ¡؃ܧ~· ¡ÿÿÿÿÿÿÿÿ`�`�‹·ÿÿÿÿÿÿÿÿ(„—·±·ÿÿÿÿÿÿÿÿ †Ї¾·ÿÿÿÿÿÿÿÿø‡I¨зÿÿÿÿÿÿÿÿ8ˆd¨á·ÿÿÿÿÿÿÿÿ€ˆ˜‰ê·ȉÿÿÿÿÿÿÿÿò·ø‰ò·ù·ȉÿÿÿÿÿÿÿÿ¸ø‰¸¸¸ÿÿÿÿÿÿÿÿ.¸ ‹.¸4¸ÿÿÿÿÿÿÿÿ0�>¸K¸U¸ÿÿÿÿÿÿÿÿܧŽl¸t¸ÿÿÿÿÿÿÿÿˆ�ƒ¸—¸ÿÿÿÿÿÿÿÿ@�’£¸ÿÿÿÿÿÿÿÿH’ª¸³¸ÿÿÿÿÿÿÿÿÈ’½¸Ô¸ÿÿÿÿÿÿÿÿÈ’½¸Þ¸ÿÿÿÿÿÿÿÿˆ”Ø•ð¸ÿÿÿÿÿÿÿÿ–ü¸Þ¦ÿÿÿÿÿÿÿÿH˜ü¸¹ ¡™�”¶ ¡ÿÿÿÿÿÿÿÿ`�`�œ§ÿÿÿÿÿÿÿÿ`�`�cª ¡ÿÿÿÿÿÿÿÿ`�`�¶ ¡ÿÿÿÿÿÿÿÿ`�`�iª ¡ÿÿÿÿÿÿÿÿ`�`��žÿÿÿÿÿÿÿÿ`�`�E· ¡ÿÿÿÿÿÿÿÿ`�`�Ò¶º¥ÿÿÿÿÿÿÿÿ`�`�ù¶F¢ÿÿÿÿÿÿÿÿ`�`�å¶F¢ÿÿÿÿÿÿÿÿ`�`�¬ ¡ÿÿÿÿÿÿÿÿ`�`�L¯ ¡ÿÿÿÿÿÿÿÿ`�`�7­ ¡ÿÿÿÿÿÿÿÿ`�`�Ý« ¡ÿÿÿÿÿÿÿÿ`�`�J­ ¡ÿÿÿÿÿÿÿÿ`�`�½« ¡ÿÿÿÿÿÿÿÿ`�`�“¨º¥ÿÿÿÿÿÿÿÿ`�`�¥žÿÿÿÿÿÿÿÿ`�`�›žF¢ÿÿÿÿÿÿÿÿ`�`�|§ÿÿÿÿÿÿÿÿ`�`�°ÀÊÚ   t°Û¸Ûõþÿo°Ð ø ¾ Ø<ˆ`”ðp€ ûÿÿoþÿÿo`ÿÿÿoðÿÿoŽùÿÿoP¨:0 @ P ` p € �   ° À Ð à ð ¡¡ ¡0¡@¡P¡`¡p¡€¡�¡ ¡°¡À¡Ð¡à¡ð¡¢¢ ¢0¢@¢P¢`¢p¢€¢�¢ ¢°¢À¢Ð¢à¢ð¢££ £0£@£P£`£p£€£�£ £°£À£Ð£à£ð£¤¤ ¤0¤@¤P¤`¤p¤€¤�¤ ¤°¤À¤Ð¤à¤ð¤¥¥ ¥0¥@¥P¥`¥p¥€¥�¥ ¥°¥À¥Ð¥ÿÿÿÿclamdtop-1.4.6-1.el9.x86_64.debug‹Õüý7zXZæÖ´F!t/å£à—#]?‘E„h=‰¦ÚŠáƒ2NÙÁ•h¦Ù)«§“ÕºzóD„ÓÕ‘Aç0”iÌ�—òAévâV»%ôÁ�©|VnA¶CÀìA'­âÔÙméŠÛÊy�@Hî¢1K ý•ûÃ�:Gþ}ë^òW†uóÖÕ¢ûˆã¼×€’ò# P_3@p¿ÿ.±A0eÙT›¨åÓÂß@…Å„–Ý@¼¼ÜÐn×ߊ†p£V=€$¦ú …ëéIA; ›j—»è½¡2|�'«fe+@Ç2é6ñ¢ñÈþÅ-¸K³ªfØèG„b!DÒPËb´WÀ¡ X�–rxOjYU�X\š/U/þâq?·°åj[ç©©aÂÜÏØ…1*ÆêSI*Ù¯ÚÄ„Sí[�»›3sg‚à!¨z\Ž"%îÛø^Q"«ò`TrJ©ë$Exl.­ é”ʹnfÝJ•ô‡>&éö=‡iµ*â?£>’g ,?£ºøä¯oæFÈ�Ø×ä#:ØÄš|f¼³~JšÛªæzsþVOjÏã¶Ö†…£ÈbŸòÇpú¿a¨cú3(õe€ÕéøJÚºtmÌ“©™#9j0[zÛÛë¸Ç’±‰‚BÂH¼©é¦ºÊ¬‹Ö"¼À6�I*ù[.Q¨[²Úðv¼A ÛÕæ£ƒVü²‚­s¨¡$7ï(J]D!*M3¢K­ðÑV÷©¤3¬¬¡tm\QÔwÖbNA¹$<Í\—3MƒP]Nœ'â¾[z“q/ †M3þpÈ­1x<úUí-_K¢,}õŪx×þ0ž4Jdä¡ÞDcYæÌ½}5°ˆ÷C–¾‘8f:W�dEnÿÒJÁ@K”�’©IîÚ{,bÐàÎR Aüw vÈ.µ™h7 ·)ÚijÁ¶%OsÝv²óú˜“v„t#Ž„ÒCq6U„� Y­¦÷UÆ– �7¾~ÄÔ÷¶kuv¶�ËA¤S?è•cŒñ\ î_®yOv´ÄlÑ^Q5��H’×Í-žl礣�›ŸYß÷ Þ>•�­ýÙUaœo8x&¦²w’* is§ÙoИ‰jîÅRYÜÆ…šB[•c½÷T^©­ZM$ÂTÆôàôc"­N€ýI*kç‰b‚¸iŸ½àóת&6–žÇFñTÞ÷¯¸ÜÁñ]úRæøS½ÙýIüfPŸûŠÑÌ®akIcwÁ öÿAÖ&p±™Ô9[“,¯ìÐKÒól»èÏEI¡¤Ê:M*¤ÿ´ƒ§—s6GÚ±r`âœrø,ËÈ–ÃVÁmÿŠL)ƒO5,‚Þ˜âÕL$$Þ`}·Öt™€<_à`‚¼‘Kkd